KEGG   Shewanella halifaxensis: Shal_2605Help
Entry
Shal_2605         CDS       T00654                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
shl  Shewanella halifaxensis
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:shl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3160360..3160920
Genome map
AA seq 186 aa AA seqDB search
MVFSSFPLSAAPILILGDSLSASYGMPEDQGWVQLLREKMPDHSIINGSVSGETSAGGLR
RLPALLESAQPELLLIELGGNDGLRGFPPKQLKTNLTKIIELAKAQQVTILLSEIMVPPN
YGPRYASQISTVYKELATEHEVTLMPFFMEQIAIDPSLMQRDGIHPNQKAQPAIAEFMLP
WLKQAL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttggttttcagcagttttccactgagtgctgcccctatattaatcctaggtgatagccta
agtgcaagttatggcatgcccgaagatcagggatgggtgcaattattacgtgaaaagatg
ccggatcacagcattataaatggctctgtgagtggagagacttcagcaggtggtctacgt
agactccccgcgctacttgaatctgctcaacctgaactgttattaattgaacttggcggt
aacgatggactacgtggttttccacccaagcagctgaaaacaaatcttacaaaaattatc
gagcttgctaaggcacagcaggtcacgattttgctcagcgaaattatggttccccctaat
tatggaccaaggtatgcgtcacaaataagtaccgtctataaagagctagcgactgaacac
gaagtgactctgatgccattttttatggagcagattgctatagacccctccttaatgcag
cgagatggcatccaccccaatcaaaaagcacaaccagccattgcagagtttatgttgcca
tggcttaaacaggctttataa

DBGET integrated database retrieval system