KEGG   Shewanella halifaxensis: Shal_2605Help
Entry
Shal_2605         CDS       T00654                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
shl  Shewanella halifaxensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Shal_2605
Enzymes [BR:shl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shal_2605
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Shal_2605
Lipid biosynthesis proteins [BR:shl01004]
 Fatty acid synthase
  Component type
   Shal_2605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3160360..3160920
Genome map
AA seq 186 aa AA seqDB search
MVFSSFPLSAAPILILGDSLSASYGMPEDQGWVQLLREKMPDHSIINGSVSGETSAGGLR
RLPALLESAQPELLLIELGGNDGLRGFPPKQLKTNLTKIIELAKAQQVTILLSEIMVPPN
YGPRYASQISTVYKELATEHEVTLMPFFMEQIAIDPSLMQRDGIHPNQKAQPAIAEFMLP
WLKQAL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttggttttcagcagttttccactgagtgctgcccctatattaatcctaggtgatagccta
agtgcaagttatggcatgcccgaagatcagggatgggtgcaattattacgtgaaaagatg
ccggatcacagcattataaatggctctgtgagtggagagacttcagcaggtggtctacgt
agactccccgcgctacttgaatctgctcaacctgaactgttattaattgaacttggcggt
aacgatggactacgtggttttccacccaagcagctgaaaacaaatcttacaaaaattatc
gagcttgctaaggcacagcaggtcacgattttgctcagcgaaattatggttccccctaat
tatggaccaaggtatgcgtcacaaataagtaccgtctataaagagctagcgactgaacac
gaagtgactctgatgccattttttatggagcagattgctatagacccctccttaatgcag
cgagatggcatccaccccaatcaaaaagcacaaccagccattgcagagtttatgttgcca
tggcttaaacaggctttataa

DBGET integrated database retrieval system