KEGG   Shewanella halifaxensis: Shal_3051Help
Entry
Shal_3051         CDS       T00654                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
shl  Shewanella halifaxensis
Pathway
shl00480  Glutathione metabolism
shl00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Shal_3051
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Shal_3051
Enzymes [BR:shl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Shal_3051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABZ77599
JGI: Shal3051
UniProt: B0TPF2
Position
3720791..3721273
Genome map
AA seq 160 aa AA seqDB search
MTASIYDFSVKDIQGQTVSLADFKDQVILIVNTASECGFTPQYRELEALYQKHQTQDFVV
LGFPCNQFGAQEKGDNQTISTFCQLNFGVTFPLFEKIEVNGANTAPLYVYLKHSAKGLLG
SERIKWNFTKFLVNKKGLVTQRFAPTTNPMAIEAEILKLL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttcaatttatgatttttcagtgaaggatattcaggggcaaacggtttcactg
gcggactttaaagaccaggtcatcttaatcgtcaatacagctagtgagtgtggctttacc
ccccaatatagggaactcgaagctctatatcagaagcatcaaacacaagattttgtggta
ctcggttttccctgcaaccagtttggcgcgcaagaaaaaggcgataaccaaaccattagc
actttttgtcagttgaactttggtgtgacctttcctctatttgaaaaaatagaggtcaat
ggtgctaacaccgcaccgctttatgtctacttaaaacattccgctaagggtttgctgggt
tctgagcggatcaaatggaactttactaagtttctagtcaacaaaaaggggctagtcacg
caacgctttgcaccaacaacaaaccccatggcgattgaagctgaaatattaaagctgctt
taa

DBGET integrated database retrieval system