KEGG   Shewanella halifaxensis: Shal_3135Help
Entry
Shal_3135         CDS       T00654                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
shl  Shewanella halifaxensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Shal_3135 (deoA)
Enzymes [BR:shl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Shal_3135 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3825715..3827046)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNAEVLSTEEIQFFVNGITNNTVSEGQIAAFGMAVYFNDMNMDERIALT
TAMRDSGTVLDWKSLDLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYNTEPDSALFRKVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLAAGLDALAMDVKVGTGAFMPTYELSEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAVDFMTGAYRNPRLYEVTMGLCAEMLVLGGIASNEAEARVKL
NAVLDNGKAAEIFGRMVSGLGGPADFVENYSKYLPDSQIIRPVYADRAGFASAMDTRELG
LAVVTLGGGRRKPGDVLDYSVGLSKVCALGDEINADKPIAFIHAQSEGAFAEAEAAVKKA
IHIGDTKPDKTPEIYRYIRESDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagctcaagaaattattcgtaaaaaacgtaatgctgaagtcctttcgactgaa
gagatccaattcttcgtcaacggtatcaccaacaatactgtttcagaaggtcagatcgca
gcctttggtatggcggtctatttcaatgacatgaacatggatgaacgtattgcgctgact
acagcgatgcgtgactctggtacagtgctagactggaaatcgctcgatcttaatggtcca
attattgataagcactcaactggtggtgtgggagatgtcattagtttgatgttaggccca
atggctgctgcttgtggtggttatgtgccgatgatctctggtcgtggtttaggccatact
ggcggtacgctcgacaagtttgatgccattcctggttataacaccgaacccgacagtgcg
ctgttccgcaaagttgtaaaagaagccggtgtggccattattggtcaaacgggcgatctt
gttcctgccgataagcgtttctattctattcgcgataataccgctacggttgagtctatc
tctttaatcacagcctccattctttctaaaaagcttgctgctggtcttgatgctttggcg
atggacgttaaagtcggtactggcgcgtttatgcctacctacgaattatcagaagagttg
gctcgcagtattactgctgtcgcaaacggtgcaggcactaagacaacggcattacttacg
gatatgaaccaagttctggcttcatgtgcgggtaatgcggtagaggtgaaagaagcggta
gactttatgacaggtgcttaccgtaaccctcgtctatatgaagtgactatgggtctttgt
gccgaaatgttagtactgggcgggatcgcaagtaacgaagccgaagcgcgcgtaaaacta
aacgctgtactggataacggtaaagcggcagagatctttggtcgtatggtgtcaggccta
ggtggtccagcagatttcgttgagaactacagcaagtacctacctgattctcaaattatt
cgtccagtgtatgcggacagagccggttttgcatcggcaatggatacccgtgaacttgga
cttgcagtcgttaccttaggtggcggtcgtcgtaagccaggagatgttctggactatagt
gtcggactttctaaggtctgtgcgctaggcgatgagatcaatgccgataagccgattgca
tttattcatgctcaatctgaaggtgcctttgctgaagctgaagctgcagtaaagaaagcg
attcatattggcgataccaaaccagacaaaactccggaaatttatcgttatatccgcgag
tctgatctgtaa

DBGET integrated database retrieval system