KEGG   Shewanella halifaxensis: Shal_3151Help
Entry
Shal_3151         CDS       T00654                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shl  Shewanella halifaxensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shal_3151
   01230 Biosynthesis of amino acids
    Shal_3151
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shal_3151
   00051 Fructose and mannose metabolism
    Shal_3151
   00562 Inositol phosphate metabolism
    Shal_3151
Enzymes [BR:shl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shal_3151
Exosome [BR:shl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shal_3151
  Exosomal proteins of bladder cancer cells
   Shal_3151
  Exosomal proteins of melanoma cells
   Shal_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3846944..3847726)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAQLAQELFKKFATKLQDDSAEVVLCPPSIYLESVRQLLDENKE
ALNGCLVRMGAQNLSQHDFGAYTGEISGQMLKDSGCRYVIIGHSERRRMYGETSVIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDVVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGVSLNATEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcccatggttgctggtaattggaaaatgaatggcagtgcgcaactt
gcgcaagagcttttcaaaaaattcgctaccaagctccaagatgattcagcggaagtggta
ttgtgtccaccttctatttacttagagagtgtacgacagctactggatgaaaataaagaa
gccttaaatggttgcttagtcagaatgggcgcgcaaaacctaagtcaacatgactttggt
gcttatactggtgaaatatctggtcagatgttaaaagattccggatgtcgatatgttatt
atcgggcattcagagcgtcgccgtatgtacggagagacgagtgttatcgtggcagagaaa
tttgctgcagctcagaaacatggtttgaccccaatattatgtgttggtgagtcgggtcca
gctcgtgaagcaagacgcacttttgaagtgattgccgaagagttagatgtggtcattgaa
aaaaatggtaccatggcttttgacaacgcaattatcgcctacgagccattatgggcagta
gggacaggtaagagcgctacgccagagcaggcacaggaagttcatgcgtttattcgcaaa
cgcctctctgaagtatctccatttatcggagaaaatatcaggattttgtacggtggtagc
gtaacaccgagtaatgcagcagacttgtttgctcaacctgatgtagacggtggattgatt
ggcggtgtaagcctcaatgctaccgaatttctcagtttatgtacgatagcgatgagcgca
taa

DBGET integrated database retrieval system