KEGG   Shewanella halifaxensis: Shal_3153Help
Entry
Shal_3153         CDS       T00654                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
shl  Shewanella halifaxensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:shl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3849355..3850143)
Genome map
AA seq 262 aa AA seqDB search
MGILNVTPDSFSDGGEYSSFETACRQADLMVAQGAKIIDIGGESTRPGAKEVSVEDELAR
VLPLIDYVSRTHKVWISIDTSKATVMKAAVEAGAHLINDVRALQEAGALDVAAQLGVPVC
LMHMQGQPRTMQDAPHYEDIISDISQFFCERIDACLAAGIRREQIVLDPGFGFGKSLAHN
YELLNRMPELLQLGLPVLAGLSRKSMFGQLLGREVSQRLSATLTGNMLAIQAGAKILRVH
DVQETSDMLAVLSATRNYNALS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggggatcctcaatgtcacgcctgactcattttctgatggcggtgagtactcatcgttc
gaaaccgcctgccgacaagccgatctaatggtggctcaaggggcaaagattatcgatatc
ggtggcgagtcgacccgtccaggcgcgaaagaggtgtctgttgaagatgagctggctcga
gtgcttccgttaatcgattacgttagccgcacccataaggtgtggatctcgatagatacc
agtaaggcgaccgtgatgaaggcggctgttgaggcaggggcacatctaattaatgacgtt
agagcactgcaagaggctggagcattagacgttgccgcccaattgggtgtgccagtttgc
ctgatgcatatgcaggggcagccaagaacgatgcaagatgcccctcattatgaagatatt
atcagtgacattagccagtttttttgtgaacgcatcgatgcttgtcttgcggcaggtata
aggcgtgagcaaatcgtgctcgatccaggctttggttttggtaaatctctcgctcacaat
tatgagctgcttaatcgaatgcctgagctattgcaattgggcttacctgttcttgcgggt
ttatcgcgtaagagcatgtttggacagttactcggacgtgaggtatcacaaagactcagt
gccacacttactggtaatatgttggcaatacaagcaggtgcaaaaatattgcgagtgcat
gatgtgcaagaaaccagcgatatgctcgcggttttaagtgcaacaaggaattataacgct
ttaagctaa

DBGET integrated database retrieval system