KEGG   Shewanella halifaxensis: Shal_3170Help
Entry
Shal_3170         CDS       T00654                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
shl  Shewanella halifaxensis
Pathway
shl00330  Arginine and proline metabolism
shl00332  Carbapenem biosynthesis
shl01100  Metabolic pathways
shl01130  Biosynthesis of antibiotics
shl01230  Biosynthesis of amino acids
Module
shl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Shal_3170
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Shal_3170
Enzymes [BR:shl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Shal_3170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA GCD14_N
Motif
Other DBs
NCBI-ProteinID: ABZ77717
JGI: Shal3170
UniProt: B0TQC5
Position
complement(3871584..3872702)
Genome map
AA seq 372 aa AA seqDB search
MNLSEISYRRVVVKLGTSVLTSGSLKLDKAHMVELARQMACLMKAGVEVVLCTSGAIAAG
KEHLGYPQLPDTIASKQLLAAVGQSQLILAWSQLFSIYGLHVGQLLLTRADLHDRERYLN
ARDSLNALLNNGIIPIINENDAVATAEIKVGDNDNLSARAALLCDADLLILLTDQKGLFD
ADPRKNPDAKLITEVQNIDDSLRMLAGGAVSGLGTGGMATKLEAADIARRAGVEVVIASG
HHKDVIQNVVCAKPVGTHFTALEHPLESRKQWILAGPKARGQVVLDTGAITAVTQKGRSL
LSKGIIEVNGLFQRGDTIELVDTKGKVYAKGMSRYGSLDVSKIAGKHSDNIEEILGYDYG
DAVVHRNDMVVL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaagtgagattagttaccgccgcgtagtggttaaattgggaacaagtgtactg
acatctggcagcttaaagttagataaagcgcacatggttgaattagcacgacagatggct
tgcttgatgaaagcaggtgttgaggtcgtattgtgtacctcgggagcaatcgctgcgggt
aaagagcatttaggctacccccaattacccgataccatagccagtaaacagctgctcgct
gcggtagggcaaagccagctaatccttgcttggtctcagttatttagtatttatggtttg
cacgttggccagctattgctgacccgcgccgatctgcatgacagggagcgctatttaaac
gctagagactctcttaatgcgctgcttaacaatggcattatcccaattattaatgaaaat
gacgccgtagcaacggccgaaattaaagttggcgacaacgataatctgtctgctagagcc
gcactgctatgcgatgcagatttgttgatcttattgaccgaccaaaaaggtctatttgac
gccgacccgcgtaaaaaccctgatgcaaagctgatcaccgaagtccaaaacatcgatgat
agcctacgtatgttggctgggggcgcggtttcaggccttggtacgggtggaatggcgact
aagcttgaagctgcggatattgcacgtcgtgcaggtgttgaagtggtgatcgcatcggga
catcataaagatgtcattcaaaatgtagtgtgcgcaaagcctgtcggtacccattttact
gcgcttgagcatccgcttgagagccgtaaacagtggattctggccgggcctaaggctcgt
ggtcaagtcgtgctggatactggtgcaattacagcggtaacccagaaaggcagaagcttg
ctctctaaagggatcatcgaggttaacgggctatttcagcgcggcgataccatagaactt
gttgatactaagggtaaggtttacgccaagggcatgagtcgatacggctcgcttgatgtc
agtaagattgctggtaagcactctgataacatcgaagagatactaggctacgattatggt
gatgcagtagttcaccgcaacgacatggtggtgttatga

DBGET integrated database retrieval system