KEGG   Shewanella halifaxensis: Shal_3214Help
Entry
Shal_3214         CDS       T00654                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
shl  Shewanella halifaxensis
Pathway
shl00900  Terpenoid backbone biosynthesis
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Shal_3214
Enzymes [BR:shl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Shal_3214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C SPOR
Motif
Other DBs
NCBI-ProteinID: ABZ77761
JGI: Shal3214
UniProt: B0TR30
Position
3918361..3919215
Genome map
AA seq 284 aa AA seqDB search
MTAPLSLGWPAPAKLNLFLHINARRHDGYHELQTLFQFVEHCDYLDFKVLDKPELKLHSN
LAGVVADSDNLILKAAKSLQQHTKCQFGVEIWLDKRLPMGGGLGGGSSDAATTLVALNQL
WETGLSATELCELGLKLGADVPVFINGFSAFAEGVGEKLQNVEPAEPWYLVLVPQVHVST
AEVFQDPELPRNTPKLSLESLMNSPWQNDCQSLVAKRHPQVAKTLGWLLEYAPSRMTGTG
ACVFGQFEQEQEAKDVLAKLPASIQGFVAKGANISPLMLRLAQC
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccactttcattgggctggccagcaccagcaaaacttaatctattcctgcat
atcaatgcacggcgccatgatggatatcacgaactgcaaaccttgtttcagttcgtcgaa
cattgtgactacttagactttaaagtgttagataaacccgagctcaaattacactcaaat
ttggctggcgttgttgctgacagcgataacttaattcttaaagccgcaaaatcactacag
cagcatacaaaatgtcagtttggcgtcgaaatttggctcgataaacgtttacctatgggc
ggcggtctcggcggtggttcctctgatgccgctacgactttagtcgccctgaatcagcta
tgggaaacgggcttgtctgcaacggaactctgcgagttaggtttaaagctaggcgcagat
gttcctgtttttattaatggtttttcggcatttgccgaaggcgtcggtgagaaactgcaa
aatgtcgaaccagccgagccctggtatcttgtattagtccctcaggtccatgtctctacg
gctgaagtatttcaagacccagaactgcctcgtaatacgccaaagctcagtcttgaatca
ttaatgaatagcccatggcaaaatgactgccaatcattagtcgcaaaacgccaccctcaa
gttgccaagaccttaggctggctgctagaatatgcgccgtccagaatgaccggaacagga
gcttgtgtttttggtcaattcgaacaggagcaagaagctaaagatgtattggcgaagttg
ccagcatcgatacaaggctttgttgcgaaaggggcaaacatatcgccgttaatgctgaga
ttagctcagtgttaa

DBGET integrated database retrieval system