KEGG   Shewanella halifaxensis: Shal_3535Help
Entry
Shal_3535         CDS       T00654                                 

Definition
phospholipase A(1)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
shl  Shewanella halifaxensis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:shl00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:shl00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:shl00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:shl00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:shl00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4311470..4312435
Genome map
AA seq 321 aa AA seqDB search
MNKFAALLLASGLCCSFSLYAQSEAQTSKSEESETEASKISIEVTPKTKVSLVDKRISEE
SATGELPYVITPHKVNYILPVTYSKSPNMAPFADEAAEHPFTLDNMEAKFQISFKFPLWH
NVFGDNGHLFAAYTNQSYWQVYNKDISSPFRETNHEPEIFMIFTNDWQLGPLKNSFWGFG
AVHQSNGQSGPKSRSWNRLYGMMVFDNGPFALEARAWWRIPEDEKETPDSPKGDDNPDIT
DYMGNLELTGVYGLDEHRFTLMVRNYIQKPNYGALEFTWSYPILGNLRLYTQYFNGYGES
LIDYNVHNQRIGIGVSINDIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatttgctgcgctactcttagcctcaggcttgtgctgttcttttagcctttat
gctcagagcgaggctcaaaccagcaagagtgaagaaagcgaaactgaagcaagtaaaatc
agtattgaagtaacgcctaagacaaaggtgtctctggttgataaacggatctcggaagaa
agcgcgactggtgagcttccttacgtcattacgccccataaagtgaactatattctgccg
gtgacctatagcaaatcacccaatatggccccctttgcagatgaagccgccgagcatccc
ttcaccttagataacatggaagccaagtttcaaatcagctttaagtttccactttggcac
aatgtctttggtgacaacggccacctgttcgcggcttacaccaaccaatcctattggcag
gtatacaacaaagatatctcctcaccgtttagagaaaccaatcacgaaccagagatcttc
atgatctttaccaatgactggcaactgggaccgctgaaaaactctttttggggctttggc
gccgtgcatcaatccaatggccagtcagggcctaagtcccgcagttggaaccgtttgtac
ggcatgatggtattcgataatggcccctttgctctcgaagctagagcatggtggcgtatt
cctgaagatgaaaaagagactcctgactctccaaagggcgatgataacccagatattacc
gattatatgggtaacctagagctcactggcgtatacggcctcgatgagcatagatttact
cttatggtgcgtaactacattcaaaagcctaactatggcgcactggagttcacctggagc
tatcctattctgggtaacttaagactttatactcaatattttaatggctacggtgaaagt
ttgatcgactacaatgtacataaccaacgcataggtatcggggtttcgattaacgacatc
ttgtag

DBGET integrated database retrieval system