KEGG   Shewanella halifaxensis: Shal_3692Help
Entry
Shal_3692         CDS       T00654                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
shl  Shewanella halifaxensis
Pathway
shl00520  Amino sugar and nucleotide sugar metabolism
shl00550  Peptidoglycan biosynthesis
shl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shal_3692
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shal_3692
Enzymes [BR:shl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Shal_3692
Peptidoglycan biosynthesis and degradation proteins [BR:shl01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Shal_3692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABZ78232
JGI: Shal3692
UniProt: B0TUW5
Position
complement(4494527..4495789)
Genome map
AA seq 420 aa AA seqDB search
MDKLKIEASGALAGNVVISGAKNAALPILMAGVLAETDFNVSNVPNLRDVNTSCELLRCL
GAEVTRSGTDKVCISTTNLNEFCAPYELVKTMRASILILGPLLARYGTADVSLPGGCAIG
ARPVNLHLQGLEQMGAKIEVKEGYIKARVDGRLKGAHIFMDMISVGATENLLMAAALADG
ETIIENAAREPEVVDLANCLIAMGAKIEGAGTDTVRIQGVESLQGCDYQVMPDRIETGSF
LVAAAVTRGKIRCTKADPKTLESVLAKLEDAGASITTGDDWIELDMQGKRPKAVNIKTVA
YPGFPTDMQAQFCVLNALAEGTATITETIFENRFMHVPELSRMGATMELEGNTCIIHGIE
KLNGAQVMATDLRASASLVIAGLVAEGTTIVDRIYHLDRGYEHIEDKFKGLGGHVERVKS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggataaattaaaaattgaagcaagtggtgcacttgctggaaacgtggttatctctggc
gctaaaaatgctgccttgccaattttaatggcgggcgtgctggccgagactgacttcaat
gtttctaacgtaccaaacctaagagatgtgaacaccagctgtgagctactgcgctgcttg
ggtgctgaagtaacccgttctggcactgataaagtgtgtatctctaccaccaatctaaat
gaattttgtgcgccgtatgagttggtaaaaaccatgcgcgcatcgattcttattctaggc
cctctacttgcacgctacggtactgccgatgtgtctctgccgggtggctgcgccattggt
gcacgtcctgttaacttgcacttgcaaggtcttgagcagatgggcgccaagattgaggtt
aaagaaggctatatcaaagcacgtgttgacggtcgtttgaaaggcgcgcatatctttatg
gatatgatcagcgttggcgcgacggagaacttgctaatggctgcagcactggccgatggt
gaaaccattatcgaaaatgctgcccgtgagcctgaggtcgtagatttggctaactgccta
atcgcaatgggtgccaagattgaaggtgcgggtaccgataccgtgcgtattcagggcgtg
gagtcactgcaaggctgtgactaccaagtgatgcctgaccgcatcgaaaccggaagtttc
ttggtcgctgcggctgtgacgcgcggtaaaatccgttgcactaaggctgatcctaaaacc
cttgagtctgtgctggctaagcttgaagacgctggcgcatcgatcacaacgggtgatgat
tggattgagcttgatatgcagggtaaacgtcctaaagcggtaaacatcaagactgtagct
tacccaggtttcccaaccgatatgcaggcgcaattctgtgtgcttaacgcactcgccgaa
ggcaccgcaaccattaccgaaaccattttcgaaaaccgctttatgcatgttcctgagctt
agccgcatgggcgcaaccatggagcttgaaggtaatacctgtatcatccatggcatcgag
aagcttaacggtgcgcaggtgatggcaacggatctacgtgcgtcagcaagccttgtgatt
gcaggtcttgtggctgaaggaacgacgattgttgatcgtatctatcacttagaccgtggt
tatgagcatattgaagataagtttaaaggcttaggcggacacgtcgagcgtgttaagtcg
taa

DBGET integrated database retrieval system