KEGG   Shewanella halifaxensis: Shal_3888Help
Entry
Shal_3888         CDS       T00654                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
shl  Shewanella halifaxensis
Pathway
shl00860  Porphyrin and chlorophyll metabolism
shl01100  Metabolic pathways
shl01110  Biosynthesis of secondary metabolites
shl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Shal_3888
Enzymes [BR:shl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Shal_3888
Exosome [BR:shl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shal_3888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABZ78428
JGI: Shal3888
UniProt: B0TJ25
Position
4710980..4711990
Genome map
AA seq 336 aa AA seqDB search
MNIITSAYPQRRMRRMRKHEFSRRLMAENQLTVNDLIYPMFVLEGNNRTEQIASMPGVER
LSIDLLLKEAEELVELGIPLIALFPVTPAEKKTLMAEEAYNADALAQRAVRALKEAFPQL
GVMTDVALDPFTTHGQDGIIDETGYIMNDVTTEILVKQALSHAEAGADIVAPSDMMDGRI
GAIRKALEEAGHVNTQIMAYSAKYSSNYYGPFRDAVGSAGNLKGGNKHSYQMDPANSDEA
LHEVALDIQEGADMVMVKPGMPYLDIVHRVKTELAVPTFAYQVSGEYAMHMAAIQNGWLA
EKAIVMESLLCFKRAGADGILTYFAKRAAQWLKEDK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattattactagtgcctacccacaacgtagaatgcgccgtatgcgtaaacatgaa
tttagtcgtcgtctaatggctgagaatcagctaaccgtcaatgacttgatctaccctatg
tttgtcttagaaggtaacaaccgcacagaacaaatagcttctatgccaggtgtagaacgc
ctttcaattgatctactacttaaagaagctgaagagctagtagagcttggcatcccgcta
atcgcattattcccagtaactccagctgagaaaaaaacattaatggctgaagaggcctac
aatgccgatgcattagcccagcgtgccgtacgtgcattgaaggaagcatttcctcaacta
ggtgtgatgacggacgttgcactagatccgttcactacacatggtcaagacggtatcatc
gatgaaaccggctacatcatgaatgacgtcaccactgagatcttagttaaacaggcattg
tctcatgctgaagcgggtgcagatattgttgctccttcagatatgatggatggtcgtatt
ggtgctattcgcaaggcgcttgaagaagctggccatgtgaatactcaaatcatggcatat
tcggctaaatactcttctaactactatggtcctttccgtgacgcagtaggctcagcgggt
aacttaaaaggtggcaataagcacagctaccagatggatccagctaacagcgatgaggca
ctacatgaagtggctttagatatccaagaaggcgctgatatggttatggttaaacctggc
atgccatacctagacatagtacaccgcgttaagactgagcttgcggtcccgacctttgca
tatcaggtaagtggtgaatacgctatgcacatggcagcaattcaaaatggttggttagcc
gagaaagctatcgtaatggaatcattgctttgctttaagcgcgcaggagcagacggcatt
ctaacttactttgctaaacgtgcagctcagtggttaaaagaagacaaatag

DBGET integrated database retrieval system