KEGG   Shewanella halifaxensis: Shal_3918Help
Entry
Shal_3918         CDS       T00654                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
shl  Shewanella halifaxensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Shal_3918
Enzymes [BR:shl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Shal_3918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4754701..4755432
Genome map
AA seq 243 aa AA seqDB search
MKVLLTRPEGRNQLMAEALTKRNVSYFITPLLNVQPTSNLDAQQIDMTLKQADIIIFIST
NAVSFASKAINNQWPTSAHYLAVGDATHAALSDIGLDAEKAPEDCQQTEGLLTLPTLTQV
NGKNILIVRGQGGREDLATELTKRQARLNYWEVYKRGCPALDAACLCQQWQSFGIDTIII
TSGEILDNLVKTVPKELFAWLQTCHIIVPSSRVYEKAKAYGLVQISNATAANTNAMLATL
SLK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcttactgacgcgtcctgaagggcgcaatcagttgatggcagaggcgttgaca
aagcgcaacgtctcttacttcatcacgcccctacttaatgttcagcccacctctaacctc
gacgcccagcaaattgatatgacgcttaaacaagccgatatcatcatttttatcagcacc
aatgcggttagctttgcttctaaagcgatcaataatcaatggcctacatctgcccattat
cttgcggttggcgatgccactcacgcggcgcttagcgacataggccttgatgcagagaaa
gctcctgaagactgccaacaaacggaaggcctactcaccttacccacgctgactcaggtt
aatggtaaaaatattctgatagttagaggtcaaggcggacgagaagacctggcaaccgag
ctgactaaacgccaagcacgactgaattactgggaagtctataaacgtggttgccctgcg
cttgatgcagcatgcctttgccaacaatggcaaagctttggtatagacactatcatcatt
accagtggcgaaatactcgataacctcgttaaaacagtaccaaaagagctatttgcttgg
ctgcaaacttgtcatattatagtgccaagctctcgagtatatgaaaaagcaaaagcgtac
ggcctagtgcagattagtaatgccaccgccgcaaacactaatgctatgctagctacgtta
tctctaaagtaa

DBGET integrated database retrieval system