KEGG   Shewanella halifaxensis: Shal_4156Help
Entry
Shal_4156         CDS       T00654                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
shl  Shewanella halifaxensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:shl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Shal_4156
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Shal_4156
Enzymes [BR:shl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Shal_4156
Lipid biosynthesis proteins [BR:shl01004]
 Desaturase
  First
   Shal_4156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5057246..5058352
Genome map
AA seq 368 aa AA seqDB search
MKKPPIIWMNVSLFSITFACAVIFVPWYGIAYGFDAIEWLCFVVVAFASGLSITGGYHRL
WSHRTYKAHASVRFLYALGGALALQNSALHWSSDHREHHKHVDNNDKDPYSAKMGFWYSH
IGWMLREYQAQRYHDYKNVRDLQNDKIVMWQHKYYLPLLLTMNFGLPILLGWLNGDILGM
VLLAGLLRLVVVHHCTFFINSLAHVWGSQPYTDKNTARDNGFIALLTYGEGYHNYHHIFE
NDYRNGIHWWQYDPTKWLINTLAWMRLADSRRVVPQERIEYARLQMQLKRTKIKVAHLPN
SEELIEKLQAEYETLKTHLAEYYDAKKALIEAKRKQLANKQLLSQVKELKLRFKQQQKSW
HSLTASFS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctcccatcatctggatgaatgtgagtctatttagcatcacattcgcctgt
gctgtaatcttcgtgccttggtacggtatcgcctatggctttgatgccattgaatggctt
tgcttcgtggttgtcgcttttgcaagtggcctatccatcacggggggctaccatagactc
tggtctcaccgtacctataaagctcatgcttcggttcggtttctatatgcccttggtggc
gcattggccttgcaaaatagtgcgttacactggtcttctgatcaccgagagcatcataag
catgtcgataacaacgataaagatccttattcagcaaaaatgggcttctggtacagccat
ataggctggatgctgcgcgaatatcaggcccagcgttaccatgactacaagaatgttcgt
gatcttcagaacgataagatcgtcatgtggcaacacaagtattacctaccactcctactt
accatgaactttggcttgcccatcctattaggttggttaaatggcgatatcttaggcatg
gtgttgctagccggattattacgcctagtggtcgtacatcattgcacttttttcatcaac
tcactggcacatgtctggggctcgcagccctatacagataaaaacactgcccgagataat
ggcttcatcgcactgttaacttacggtgagggttaccacaactatcaccatatcttcgag
aatgactaccgtaacggtatccactggtggcagtatgacccgactaaatggctgattaac
accttagcctggatgagattagccgatagtcgtcgagtggtgccacaagagcgtattgag
tatgctcgattacagatgcagctcaaacgcaccaagatcaaggtggctcacctgcctaat
agcgaagagctgatcgagaagttacaagcagaatacgaaacactgaaaactcaccttgct
gagtattatgatgccaagaaagccttaattgaagccaagcgcaaacagcttgctaacaaa
caactgcttagccaagtaaaagagctaaaattacgctttaagcagcaacaaaaaagctgg
cacagtttgacagcaagttttagctaa

DBGET integrated database retrieval system