KEGG   Shewanella halifaxensis: Shal_4228Help
Entry
Shal_4228         CDS       T00654                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
shl  Shewanella halifaxensis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:shl00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5135600..5136574
Genome map
AA seq 324 aa AA seqDB search
MSIASEAYMPNQTTTRFSSEHHLNSPEQKVFWQQVTQSSFKTHDDITLAYARITHPDSIG
TIVISSGRVESYLKYKELMFDLYQRGYSLFALDHRGQGLSARTTANPHQGYIDKFQRYVD
DFAEFVTKIVKPHSMENYYLVGHSMGGAIGTLYLSQYPATFKAAVFSAPMYGIKLPLPRG
FIRALASLLDNHKQPNYILGGKDYHAEPFDKNDLTHSKLRYDDYRELYRQQPQLQLGSPT
NHWLVESIDAAEQAIDAARNSKIPLLILQAEEDSIVDNRAQKRAINGLCKLTKIPYARHE
IFMERDTPRNLAINALCDFLKQVR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatagctagcgaagcctatatgccaaatcaaaccacaacccgcttttcatcagaa
catcaccttaatagtcctgagcaaaaagtcttctggcagcaagtgacgcaatcgagcttt
aagactcatgacgacatcactttagcctacgcccgcattactcacccagacagtatcggt
accatagtcatcagtagtggccgagtagaatcctatctgaaatataaggagctgatgttt
gatctttatcagcgtggctacagcctgtttgcactggatcatcgcggccagggcttatcg
gcacgcacaacagccaatccacatcaggggtatatcgacaagttccagcgatatgtcgac
gatttcgccgaatttgtcactaagatagtcaaaccgcattcaatggaaaactactatctg
gttggccattcgatggggggagctatcggtacgctttatctaagtcagtatccagcgacc
ttcaaagccgcggtattttcggcccccatgtacggtatcaaactgccactccctagaggt
tttatccgcgctttagcttcactgttagataaccataagcaacccaactatatcttaggt
ggcaaagactaccatgccgaaccattcgataagaatgatctaacccacagtaagttgcgc
tatgacgattaccgcgaactctatcgacagcagccacagctacagctaggctcacccacc
aaccattggctagttgaatccatcgatgccgccgagcaagcaattgatgcggcacgaaac
agcaaaatccctttactgatcttacaagctgaagaggactccatcgtcgacaatcgtgct
caaaagcgcgccattaacggcctgtgtaagttgacaaaaatcccttatgcccgccatgag
atctttatggaacgcgatacgccacgcaaccttgccatcaacgcattgtgcgacttctta
aagcaagtgcgttaa

DBGET integrated database retrieval system