KEGG   Shewanella sp. MR-7: Shewmr7_0062Help
Entry
Shewmr7_0062      CDS       T00389                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
shm  Shewanella sp. MR-7
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shewmr7_0062
Enzymes [BR:shm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Shewmr7_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(73751..75235)
Genome map
AA seq 494 aa AA seqDB search
MKNQVQLITYVDRITGAGLKQLKALLDNELDGLFGGVHLLPFYYPIDGSDAGFDPIDHVQ
VDSRLGDWDDVKNIGEAFDIMADLIVNHMSAESPEFKDVLKHGKQSVYWDLFLTKDKVFP
EGLSEQDQKAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVNSAAGKDYLNRVLA
RFNHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANELGMTTLAEIHSHHMT
QIDIAKRVDMVYDFALPPLILHTLFSQDCSALSHWLDMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLDEKQIDNLVETIHDNSKGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYTGLLAIPNDMTLLNQTHVGRDINRPYLNREKVQQALQKPVVKA
LIQLIKLRNSSAAFNGRFSMAASGKTLTLTWSAQNASASLSLDFVHKQGLITLLDEQGIE
TQIALADLLTQAQA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaagtgcaattgatcacctatgtcgatcggataaccggtgccggactcaaa
caactcaaagccttactcgataatgagttagatggtttatttgggggcgttcatctactg
cccttttactatcccatcgatggcagcgatgcggggtttgatcccatagaccatgtacaa
gtggactcacgcttaggtgattgggacgatgtcaaaaacataggcgaagcgttcgacatc
atggccgacttgatcgttaaccacatgtccgcagaatctcccgagtttaaagatgtgctc
aagcatggcaaacaatcggtttactgggatttattcctgaccaaggacaaggtattccct
gagggattaagtgaacaggatcaaaaagctatctatcgcccccgcccagggagctgcttt
agcacttacaccttagcggatggttcaacggaagaattttggaccacctttacccgtaac
cagatcgatatcgatgttaactcagctgcaggtaaggattatttaaaccgcgtattggcg
cgatttaaccacagcaaagtcaatttaatccgcttagatgccgcagggtatgcaatcaaa
aagcccggtactagctgctttatgattgaagagtccttcgagtttgtggataaattagcg
aagcaagccaatgagttaggtatgacaaccctagccgaaatccactcccatcatatgacg
caaatcgatatcgccaaacgagtggacatggtttacgacttcgccctgccaccgctcatc
ctgcacacgctgtttagccaagattgtagcgccctgagtcactggctagacatggcccct
cgcaactgcattaccgttctcgatacccacgatggcattggtattatcgatgtcggccca
atggatggcttacgcggattattggacgaaaaacaaatcgataatctggtcgaaaccata
cacgacaacagtaagggcgagagtctacaagccacaggtgcggccgccagcaatgtcgat
ttgtatcaaatcaactgcacctattacgatgccctagggcaaaatgacctagattacttg
atggcgcgagcaattcagtttttcgcaccgggtattccgcaggtctactacactggcctg
cttgccatacccaacgacatgacgttgctgaatcaaacccatgttggccgagatattaat
cgcccctatttaaaccgggaaaaagtgcagcaagccctgcaaaaacctgtggttaaagcc
ctcatccaattgattaaactgcgtaatagtagcgcagcattcaatggccgcttttcgatg
gcagcaagtggcaaaacactgactctcacatggtccgcacaaaatgcatcggccagtctt
agtctcgactttgtccataaacaaggattgatcaccctgcttgatgagcaaggcatcgaa
acccaaatcgcattagcagacctgctcactcaagcacaggcctaa

DBGET integrated database retrieval system