KEGG   Shewanella sp. MR-7: Shewmr7_0373Help
Entry
Shewmr7_0373      CDS       T00389                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
shm  Shewanella sp. MR-7
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Shewmr7_0373
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Shewmr7_0373
Exosome [BR:shm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewmr7_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
415302..416786
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
IESLARAGIHSDEVAAIGITNQRETTIIWEKATGKPVYNAIVWQCRRSSEICEQLKAQGL
EDYVRENTGLLLDPYFSGTKIKWILDNVPDARAKAKRGELLFGTVDTWLLWKLTEGKVHV
TDPTNAARTLLFNIHSLSWDTTLLEALDIPAAMLPEVRPSCSVYGTTRIAGEGSEIPLAG
IAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGNKAVRSSHGLLTTVAVGAQGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSGERLKSLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWTSVTELEYKACIDKHFKPNIDASQRER
LYVDWQDAVARTRS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatatgtagtggctttagaccaaggcacaaccagctcaagggcgattgtg
tttgaccacgatgccaatattgtcagtgtgtcacagcgggagtttacccagctttatcca
aatcctggctgggtggagcatgatccaatggagatctgggcgagccaaagttcggtgtta
atcgaatccctcgccagagcgggtattcacagcgatgaagtggcggcgattggtattact
aatcagcgcgaaaccaccattatctgggaaaaggccacaggcaagcccgtctacaatgcc
attgtgtggcagtgtcgccgcagctcagaaatctgtgagcaactcaaggcccaaggctta
gaagattatgtgcgggagaatacggggctcctgctcgacccttatttttcaggcactaag
atcaaatggatcctcgataatgtgccggatgcgcgcgcgaaggccaaacgaggtgaactc
ttattcggcacggtcgatacttggttgctatggaaactcaccgaaggcaaagtgcatgtg
accgatcccaccaatgccgcccgcacgttgctgtttaatatccacagcctaagttgggac
acaacactgctcgaggcgctcgatattcctgcggctatgttgcccgaagtgagaccttcc
tgcagtgtctatggcacaacccgtattgccggtgagggcagcgaaattcctctcgcgggg
atcgcgggcgatcaacaggcggcgctctttggccagctttgtgttgagcctggaatggcc
aaaaacacttatggcacaggctgctttttattaatgaatacaggcaacaaagccgtacgc
tcatcccatggtttattaaccacagtagcggtaggcgctcaaggtgaagtgaactacgcc
ctcgaaggctctgtatttatgggcggcgcgacgattcaatggctgcgggatgagctggga
ttgatccgcgatgccagcgacaccgaatattttgcctctaaagtcgcggataccaatggc
gtgtatttagtgccagcttttgtcgggcttggcgctccctattgggatcctaatgcccgt
ggcgcgctgtttgggttaacgcgcggcgccaaccgtaatcatattatccgtgcggcattg
gagtcgattgcctaccagagtaaggatttgctcgatgccatgattaaggacagcggtgag
cggcttaaatcccttaaggtcgatggcggcgcggttgctaatgacttcctcatgcaattt
caagcggatatcaccgacgttgaagtcttaaggccaagcgtgtgtgagaccacagcgctt
ggcgcggcctttttagctggtcttgcggttgggttttggacctcagtgaccgaacttgag
tataaagcctgtatcgacaaacacttcaaacccaatattgatgcgagtcaaagggagcga
ttatatgtggactggcaggatgctgtagcaagaactcgctcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system