KEGG   Shewanella sp. MR-7: Shewmr7_0543Help
Entry
Shewmr7_0543      CDS       T00389                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00010  Glycolysis / Gluconeogenesis
shm00052  Galactose metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr7_0543
   00052 Galactose metabolism
    Shewmr7_0543
Enzymes [BR:shm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Shewmr7_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABI41546
JGI: Shewmr70543
UniProt: Q0HZA9
Position
complement(628753..629784)
Genome map
AA seq 343 aa AA seqDB search
MVRFSVLDPWTDPRGGEIERVRIDNGIIALEVLSLGGIIRSLWTPDKQGQRANIVLGCDS
AEDYLTQNAHLGAIAGRFANRIAMGKMQYQGQEYQLDINQASNCLHGGREGFNRKNWHLG
QLPDGVRLSLVSPDGDMGFPGNCTVQLDYRLAANNLYVEILASVDKPCPVSLTQHSYFNL
DGLPNNHQHQMQIDATRYLTMNEVGIPTGIAEVKNSIFDLTQGVTLGDKLQDPALASTQG
YDHCYLLDNPDCALRRFGCLSSPVSGRAMTVFTNQPGVQLYCANFLAGTLGRNQQSLNAY
QGVCIEPQKLPDSPNQPQLGDDAWLIPGKIYHHISRYQFDIEG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtttcagtgtactagatccttggaccgatccccgcggcggtgaaatcgaacgt
gtgcggatagacaatggcatcatcgccttagaagtgctcagcttaggtggcattattcgc
tcactttggacgcccgataaacagggccaacgcgccaatatcgtgcttggctgcgacagt
gccgaagattatctaacccaaaacgcccaccttggtgcaatcgcagggcgctttgccaac
cgtattgcgatgggcaagatgcaatatcaagggcaagaatatcaactggatatcaatcag
gccagcaactgcttgcacggtggccgcgaaggttttaatcggaaaaattggcacttaggc
caacttcccgacggtgtgcgtttatcgttagttagcccagatggcgacatgggtttcccc
ggcaattgcactgtccagttagactatcgccttgcagccaataatctctatgtggaaatc
ctcgcctcggtggataaaccttgccccgtcagtctgacacagcattcctacttcaacctc
gatggattgccgaacaatcatcaacatcagatgcaaatcgatgctacgcgctacctcacc
atgaatgaggtgggcatacctacgggaattgccgaggtcaaaaacagtattttcgattta
actcagggcgttactctaggggacaaactccaagatccggcgctggccagcacccaaggt
tatgatcattgttatctcttggacaatcccgattgcgcgctgcgccgctttggctgccta
tcgagccccgtcagcggtcgcgccatgacggtctttaccaatcagcccggcgtgcagctc
tactgcgctaactttttagcgggaaccctaggacgaaaccaacaaagtttgaacgcctat
cagggcgtgtgtattgagccgcaaaaattgcctgattcgccgaatcaaccccaactgggt
gatgacgcttggttaataccggggaaaatctaccatcatatcagccgctatcaatttgat
attgaaggctaa

DBGET integrated database retrieval system