KEGG   Shewanella sp. MR-7: Shewmr7_0641Help
Entry
Shewmr7_0641      CDS       T00389                                 

Definition
(GenBank) Twin-arginine translocation pathway signal
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00790  Folate biosynthesis
shm01100  Metabolic pathways
shm02020  Two-component system
Module
shm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shewmr7_0641
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shewmr7_0641
Enzymes [BR:shm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Shewmr7_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: ABI41644
JGI: Shewmr70641
UniProt: Q0HZ11
Position
749162..750928
Genome map
AA seq 588 aa AA seqDB search
MKRTVTRRDFLAMSAKGIGAAVISYGLMGCSDSDDDKSVPAQFLHGVASGDPAQDAVILW
TRVTPDSAGDVKVSWQVASDAAFSQLVTTGEMVTNANRDYTVKIDARGLRAGQTYFYRFM
TGGKTSEVGKTRTLPEGDVSSVKLAVMSCANFPAGYFNVYELAAAQDDLDAVVHLGDYIY
EYARGGYASEHAAELGREVLPANELLTLSDYRTRYGQYHTDASLQKLHAKVPFITVWDDH
EVANDTWRDGAENHNEGEGDFAVRKEAALQAYFEWLPIRPWREGNHEEIYRSFSYGNLVD
LHMLDTRVLARDKQLDYADYMDASTGAFDGERFRADVTSTTRTMLGLTQLLWLQGTLLQA
TGTWQVLGQQILMGKMSLPAAIATQQMSIPQYAMLGALAKLAARAAANDPTLTAAELQYL
QANQALLTPEVIALLQLPSIPYNLDAWDGYAYEREVILGTAKSKNHNLVVIAGDTHNAWA
NELKDVNGDTVGVEFATSSVSSPGLEYYLNLPAEQIPATEAAIVDLVPDLKYTNLKDRGF
MTLTFTKEAVRSDWHYVSTILAKEFEESSSRSYSAMTKVGEPIINPVS
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaccgtgactcgtcgtgattttttagccatgtcggccaaaggcattggtgca
gcagtgatctcctacggcctaatggggtgtagtgacagtgatgatgataaatctgttcct
gcgcagtttttacatggggtagccagtggtgaccctgcgcaagacgcggtgatcctctgg
acccgtgtgacgccagattctgctggggatgtcaaagtcagctggcaagtggccagtgat
gcggcattctcacaattagtgaccacaggggagatggtcaccaacgctaaccgtgattac
acggttaaaatcgatgcccgtggtttacgtgcgggacaaacctatttttaccgctttatg
acgggcggaaaaacctctgaggtgggcaagacccgcactctacccgagggtgatgtgagt
tcggtaaaacttgctgtcatgtcatgcgctaactttccagctggctactttaacgtgtat
gaattggctgcggcgcaggatgacctcgatgccgtggtgcatctgggtgactatatctac
gaatatgctcgcggcggctatgccagcgaacatgcggcagagcttggccgtgaagtgtta
cccgccaacgaactgctgaccctcagcgattaccgtacccgttacggccaatatcatacc
gatgccagcctgcaaaaattgcacgcgaaagtgccttttattacggtatgggacgaccac
gaagtggcaaacgacacctggcgtgatggcgcagagaaccacaacgaaggcgaaggggac
tttgcggtccgtaaagaagccgcgctacaggcctacttcgagtggctgccaattcgccca
tggcgcgagggtaaccatgaggaaatttaccgtagcttcagttacggtaacttagtcgac
ttacatatgctggacacgcgcgttttggcccgcgataagcagctcgactatgccgactat
atggatgccagcacgggcgccttcgatggtgagcgtttccgcgccgatgtgacatcgacc
acgcgcactatgctaggcttaacccaattactctggctgcagggcactttattgcaagcc
acgggcacttggcaggtgttagggcaacagatcctcatgggcaagatgtctctacctgcg
gcgattgctacccagcaaatgagcattccacaatatgccatgcttggggcgttggcgaag
ttagccgcccgcgctgcggcaaatgatccaaccctaactgcggcggaattacagtacttg
caggccaatcaagccctgttaacgccagaggtgattgccctgctgcaactgccatcaatt
ccctataacttggatgcatgggatggttatgcctatgaaagggaagtgattttaggtacg
gctaaatcgaaaaatcacaacctagtggtgattgccggtgacacccataatgcctgggca
aatgagttaaaagacgtcaacggtgataccgttggggtcgagtttgccacaagctcagta
tcatcacctggtttggaatattacttaaatctccctgcggaacagatcccagcgaccgag
gcggcgatcgttgacttggtgccagatcttaaatacaccaaccttaaagaccgcggcttt
atgaccttaaccttcaccaaggaagccgtgcgtagcgactggcattatgtcagcacgatt
ctggcgaaggagtttgaagagtcgagtagccgcagctacagcgccatgactaaggtcggt
gaacctattatcaaccctgtgagctaa

DBGET integrated database retrieval system