KEGG   Shewanella sp. MR-7: Shewmr7_0646Help
Entry
Shewmr7_0646      CDS       T00389                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Shewmr7_0646
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Shewmr7_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ABI41649
JGI: Shewmr70646
UniProt: Q0HZ06
Position
complement(754648..755559)
Genome map
AA seq 303 aa AA seqDB search
MSHILVIGSANADHVMNFEYLPAPGQTLMSRSYRLEHGGKGANQAVACARLCQADSRVDF
ICHLGQDSVGNEMRENWLKDGIEADGITQVANLSTGTAMIFVADNGENSIGIAAGANANL
TPPELEKHYALFVNAQYMLIQLETPMETVNHALQTAKRLGITTVLNPAPAVSQELDYLKW
VDIITPNETEAEALTGIEVNNEDDAKLAAQLLHQQGVTTVVITLGSKGAFISSAGFTGLI
PALEVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVGFANAASAITVTRAGAQRAIPYRHE
LPR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccacatactcgttataggcagtgccaacgccgaccatgttatgaattttgagtat
ttgcccgctccggggcagaccttaatgagtcgaagctaccgactagagcatggtggtaaa
ggggcgaatcaagcggtggcctgtgcccgcttatgtcaggccgattctcgagtggatttt
atttgccatttgggccaagacagcgtgggtaacgagatgcgcgaaaactggctcaaggat
ggaatagaagccgatggcattacccaagtcgccaatctgagtacaggtacggcgatgatt
tttgtcgccgataatggcgaaaactccatcggcatcgccgctggcgccaatgctaatctc
acgccaccagagcttgagaaacattacgctctgtttgtaaatgcccagtacatgctgatc
caactcgaaacgccaatggagacagtaaaccacgcattgcaaaccgccaaacgccttggc
attaccacagtgctcaaccccgcccctgctgtcagccaagaactggattatctcaagtgg
gtggacattatcaccccgaatgaaaccgaggccgaagcgttaacgggcattgaggtcaat
aacgaagatgatgccaaactggccgcccaactgctgcatcaacagggcgtgacgactgtg
gtgattaccttaggcagtaaaggggcatttatcagtagcgcaggctttaccggattaatt
cctgcacttgaagtacaagctatagacacagttgccgctggcgataccttcaatggcgcc
ttagtggtggggttaagtgagggcatgtcgattgccgccgccgtcggctttgccaacgcc
gcatccgcgatcactgtgacccgcgccggcgctcagcgcgccattccctaccgccacgaa
ctgccgcgttaa

DBGET integrated database retrieval system