KEGG   Shewanella sp. MR-7: Shewmr7_1087Help
Entry
Shewmr7_1087      CDS       T00389                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
shm  Shewanella sp. MR-7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:shm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:shm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:shm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:shm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:shm00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1253412..1254194
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDCGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSTEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcacaagagttgttcaagaaatttgcctcaaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagaaagcgtcaggcagctgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgctcagaatttaagtcaacatgactttggc
gcttataccggagaagtttcgggtcagatgcttaaagattgcggatgtcgatatgtgatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcacggtttaacccccattttatgtgtgggtgagtctggtcca
gcacgtgaagcaagacgtaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcttacgagccgttatgggccgta
gggactggtaagagcgcgacaccagagcaggcacaagaagtacatgcgtttatacgcaag
cgtctctctgaagtgtctccgtttatcggagaaaatatcaggatcttgtacggtggcagt
gtgacaccgagtaatgcggcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgccagtttaaactctaccgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system