KEGG   Shewanella sp. MR-7: Shewmr7_1192Help
Entry
Shewmr7_1192      CDS       T00389                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
shm  Shewanella sp. MR-7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1391826..1392461
Genome map
AA seq 211 aa AA seqDB search
MTRVALTSAVNLAKKLQEAGIRHPAVLKAISHTPRELFLDNALAHKAYENTALPIGQGQT
ISQPYIVARMTELLLQHQPQKVLEVGTGSGYQAAILAQLVPELCTIERIKGLQIQARQRL
KRLDLHNVSFKYGDGWQGWPNRSPFDGIMVTAAAAKVPEALLSQLAEGGVLIIPVGEETQ
QLMRFTRRSDRFSSEVIETVKFVPLVNGELA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactcgagttgccttaacatcggcggtgaatttagctaaaaagcttcaggaggcgggg
atccgccatccagccgttcttaaggcaatatcccataccccgcgcgaactgtttcttgat
aatgcgctggcccataaagcctacgaaaataccgccttgcccataggccaaggacaaacc
atttcgcagccgtatattgttgcacgtatgactgagttactgctgcaacatcagccgcaa
aaggtgcttgaggtggggactggctcgggctaccaagcggctattctcgcacaactggtg
ccagaactgtgcaccattgagcgtattaaaggtttacagatccaagcgagacaaagatta
aagcgactcgatctgcataatgtgtcattcaaatatggcgatggctggcagggctggccg
aatcgcagccctttcgatggcattatggtcacggcggcagcggctaaggttcccgaagcc
ttgttgtcccagttagccgaaggcggcgtgctgatcatccctgtgggtgaagagacgcaa
caattgatgcgctttacccgccgctcggatcgttttagttctgaagtgatagaaaccgtc
aaatttgttcccttggtcaatggcgaactcgcttaa

DBGET integrated database retrieval system