KEGG   Shewanella sp. MR-7: Shewmr7_1267Help
Entry
Shewmr7_1267      CDS       T00389                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
shm  Shewanella sp. MR-7
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:shm00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:shm00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1475768..1476379
Genome map
AA seq 203 aa AA seqDB search
MISILVSDVIENNEFANLGAPNEKDIMIKLPLVIFASLLSTSAFAATCPSYLDVEVRKLH
SDEKINLCELTQGKPVLLVNTASNCGYTPQFKALEALHKEYKDKGLVVIGFPSDDFFQEE
NDEKDTAKVCYINYGVTFTMLATSPVRGSDANSVFKYLGDKAGSPKWNFYKYVVSGDGNT
VQQFNSKVKPDSAELKQAIESVL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatctctatattagtgagtgacgtaatagagaataacgagtttgccaatcttggcgcg
cccaatgagaaggacattatgattaaactccccttagttatctttgccagcctgttaagc
actagcgcatttgcggcaacttgcccgagttatcttgatgttgaagtgcgtaaattgcac
tcggatgagaagattaatctgtgtgaattgactcagggcaagccagtgttactggtcaac
accgcgagtaactgtggctacactccgcaatttaaggctctcgaagcgcttcataaagaa
tacaaagataaaggcttagtggtgattggtttcccttccgatgactttttccaagaagaa
aatgatgaaaaagacacggctaaagtgtgctacatcaactatggtgtcaccttcactatg
ctagcaacatcgcccgtgcgaggcagcgatgctaacagtgtattcaaatacttaggggat
aaagcaggctcgcctaagtggaatttctacaaatatgtcgtcagtggcgatggcaatact
gtgcagcagtttaattctaaggtgaaacctgatagtgccgagcttaagcaggcaatagaa
tcagtgctttaa

DBGET integrated database retrieval system