KEGG   Shewanella sp. MR-7: Shewmr7_1370Help
Entry
Shewmr7_1370      CDS       T00389                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
shm  Shewanella sp. MR-7
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:shm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:shm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1586286..1587410
Genome map
AA seq 374 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIVNQDPELEVIATASNGAEAVKMAAELNPQVITMDIEMPV
MDGITAVREIMAKCPTPILMFSSLTHDGAKATLDALDAGALDFLPKRFEDIATNKDDAIL
LLQQRVKALGRRRIFRPVVRPSTPTPTPRSSASSVLGGVSTHTQPAPAPVRSSHAASIRP
SGKQYKLLLIGTSTGGPVALQKILTQFPANYPHPILLIQHMPAAFTPAFANRLNGLCKIE
VKEAVNGDVLRPGCAYLAPGGMQMMVERTGVTGRVKVLAGSAEMNYKPCVDITFASASKA
FGGDVLAVVLTGMGADGREGARMLKSAGATIWAQDEASCVVYGMPQAVASAGIATQSISL
DNMAESILKESARG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaagtattagtcgttgatgactcaagtttttttagacgacgtgttagtgaa
atagtcaatcaagatcctgaactggaagtgatcgcaacggcctctaacggggccgaagcg
gtgaagatggctgccgaacttaatccgcaagtcattacaatggacattgaaatgcctgta
atggatggtattactgctgtccgtgagattatggcgaagtgtccaacgcctatcttgatg
ttttcttcattgacccatgatggtgccaaggccacgcttgatgcccttgatgcgggggcg
cttgattttctacctaagcgattcgaagatatcgcgaccaataaagatgacgctattttg
ctattgcagcaaagagtcaaggctttaggtcgtcgccggattttccgtcctgtggtacgt
ccttccacaccaacgccgacacctcgttcgagtgcgagttcagtattaggtggggtatcg
acacatacgcagcctgcacctgcgccagttcgctcttcacatgctgcgtctattcgtcca
agtggtaaacaatataagttattgctgataggcacatcgacgggcgggcctgttgccttg
cagaaaattttgactcagttccccgcaaattatccgcatcctattttgcttatccagcat
atgccagcggcctttacgccagcctttgcgaatcgtttaaatggtttgtgtaagattgaa
gtcaaagaagcggtgaatggtgatgtattgcgtccaggatgcgcgtatttagcgcctggc
gggatgcaaatgatggttgagcggacaggtgtcacgggccgtgtcaaagtgttggcagga
agcgctgagatgaattacaagccctgtgttgatatcacctttgcttctgcctcaaaagcc
tttggcggtgatgtgctggcggtagtgttgacaggaatgggagccgacggccgcgaaggt
gcgcgtatgctgaaatctgcgggtgcgaccatttgggcacaggatgaagcgagttgtgtg
gtttatggtatgccgcaggcggtggccagtgccggtatcgctactcagtctatttcgctg
gacaatatggctgagtcgattttaaaagagtctgcgcgtggctaa

DBGET integrated database retrieval system