KEGG   Shewanella sp. MR-7: Shewmr7_1524Help
Entry
Shewmr7_1524      CDS       T00389                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00260  Glycine, serine and threonine metabolism
shm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01130  Biosynthesis of antibiotics
shm01230  Biosynthesis of amino acids
Module
shm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shewmr7_1524
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shewmr7_1524
Enzymes [BR:shm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shewmr7_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABI42522
JGI: Shewmr71524
UniProt: Q0HWI3
Position
complement(1776589..1777779)
Genome map
AA seq 396 aa AA seqDB search
MSQLKLNPYFGEYGGMYVPQILVPALKQLENAFVEAQADESFQAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQMLEREGRLPDAVIACVGGGSNAIG
MFADFIDETSVELIGVEPAGKGIDTHMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNAIGRARYESATDDEALEAFQLLARSEGIIPALESAHALAYAL
RLARECTKETILVVNLSGRGDKDIFTVSDILNGKEE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagttaaagcttaacccttatttcggcgaatacggcggtatgtatgtgccgcag
attttagtccccgccctcaagcaactcgaaaacgcctttgtcgaagcgcaggccgatgaa
tcctttcaagccgagtttaccgacctgctgaaaaactacgcaggccgaccaacggcactg
accttaacccgcaatttaagccctaatcctatggtaaaaatctaccttaagcgggaagat
ttactccacggcggcgcccataaaaccaaccaagtattaggccaagcattactggctaaa
cgtatgggtaaaaaggaaattattgcagaaaccggcgctggccagcacggtgttgccacc
gcccttgcctgtgcgctgctgggattaaaatgcaaagtgtatatgggcgcgaaagacgtt
gcccgccaatcacctaacgtatttagaatgcgtttgatgggcgcagaagtcattcctgtc
acctcaggctctgccaccttaaaagatgcctgtaacgaggcgatgcgcgactggtcaggc
agctacgaaaaagcccactatctattaggcaccgccgcagggccacatcccttcccgacc
atagtgcgtgagttccaacgtatgatcggcgaagaaaccaagaaacaaatgctggagcgc
gaaggtcgtctgcccgatgcggtgatcgcctgtgtcggcggaggctctaatgccattggt
atgtttgccgactttattgatgaaaccagtgtcgagctaattggggtcgaacccgcaggt
aaaggcattgatacccatatgcacggcgcgccactcaaacatggcaaaaccgggattttc
tttggtatgaaggcgcctttgatgcaggacagtgaaggccaaatcgaagagtcctattcg
atttcggcgggtcttgacttcccatccgtcggcccgcaacacgcccatttgaacgcgatt
ggccgtgcgcgctacgaatcggccaccgatgatgaagccctagaagccttccaattattg
gctcgcagcgaagggattatccccgcgctcgaatcggcccacgccctcgcttacgccctg
cgcctagcgagagagtgcaccaaagagaccattttggtcgttaacctctcgggccgaggc
gataaggatattttcactgtgtcagacattttaaatggtaaagaggaataa

DBGET integrated database retrieval system