KEGG   Shewanella sp. MR-7: Shewmr7_1543Help
Entry
Shewmr7_1543      CDS       T00389                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
shm  Shewanella sp. MR-7
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Shewmr7_1543
Enzymes [BR:shm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shewmr7_1543
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Shewmr7_1543
Lipid biosynthesis proteins [BR:shm01004]
 Fatty acid synthase
  Component type
   Shewmr7_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1802258..1802857)
Genome map
AA seq 199 aa AA seqDB search
MAKAVSACILLSLFITTPVQAAKVLILGDSLGASYGMSEQIGWVALLQKNLPEHEFTNGS
VSGETTAGGLRRLPALLDSVTPDLVVVELGGNDGLRGFPPTQLKNNLIQIITLAKNSGAK
VLLTEIMVPPNYGPRYTQKFTQVYQEIAKDEEIALIPFFMQDIAPHPELMQRDGIHPNEK
AQEKIATWMQPWIEKALTQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggccgtgagcgcctgcatcctgttaagtctgtttataaccacgccagttcag
gcggcgaaagtgttgatcctcggcgatagcttaggcgccagctatggcatgtcggaacaa
ataggctgggtggcgctgctgcaaaaaaatttacccgagcatgaatttaccaatggttcg
gtaagcggtgaaaccacagcgggcggtttgcgtcgtttgcctgcactgctcgattccgta
acccccgatttggtggtggtcgaactcggtggtaacgatggtttacgtggattccccccg
acgcaactcaaaaataacctaatccaaatcattaccctagcgaaaaatagcggtgctaaa
gtgctactgaccgaaatcatggtaccgcctaactatggccctcgctatacccaaaagttc
acccaagtgtatcaagagattgctaaagacgaggagattgcattaatccccttctttatg
caggacattgctccccaccctgagttgatgcaaagggacggaattcatcccaatgaaaag
gcccaagaaaagatcgccacttggatgcaaccttggattgaaaaagccttaactcaataa

DBGET integrated database retrieval system