KEGG   Shewanella sp. MR-7: Shewmr7_1707Help
Entry
Shewmr7_1707      CDS       T00389                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
shm  Shewanella sp. MR-7
Pathway
shm00020  Citrate cycle (TCA cycle)
shm00190  Oxidative phosphorylation
shm00650  Butanoate metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
Module
shm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewmr7_1707
   00650 Butanoate metabolism
    Shewmr7_1707
  Energy metabolism
   00190 Oxidative phosphorylation
    Shewmr7_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABI42700
JGI: Shewmr71707
UniProt: Q0HW05
Position
2014361..2014708
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDFILLRASAVILACYTIFMVGFIACSSPLTYDVWHGLFSALPMKVF
TLLALVALLIHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactttattctactacgc
gctagtgcagtaatcctcgcctgttataccattttcatggttggctttattgcatgtagt
tcccctctcacctatgacgtgtggcacggcctgttcagcgctctgccaatgaaagtgttt
acactgctcgcgttagttgcactgcttattcacgcttggattggtgtatggcaagtattg
acggattacgtcaagtgcacttcgttacgtggtgttttacagttcaccttcgtcgtcacc
gtcttttgctatctggcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system