KEGG   Shewanella sp. MR-7: Shewmr7_1711Help
Entry
Shewmr7_1711      CDS       T00389                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shm  Shewanella sp. MR-7
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shewmr7_1711
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewmr7_1711
  Amino acid metabolism
   00310 Lysine degradation
    Shewmr7_1711
Enzymes [BR:shm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Shewmr7_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2020276..2021472
Genome map
AA seq 398 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVSGQEVTKAEAEAAAPVAAAVTEESNDALSPSVRRLLAEH
NVDASKVKGTGVGGRITKEDVEAFIKSAPKAAAAPAAPAVQPLAAGRSEKRVPMTRLRKT
IANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQEIFEKRHGIRLGFMSFYVKAVTEALK
RFPEVNASIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDTDTMSLADIEKAVRDLAIKGR
DGKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPM
MYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactgccagaatctgttgccgacgcaactatcgcc
acttggcacgtaaaagtgggtgagcaagtttctcgtgatcaaaatctggttgatattgaa
actgacaaagtcgtactggaagtggttgcaccagaagatggtcacatcggtgagttcctg
ttccaagaaggcgataccgttctgggcgagcaagtcattgctaagttcatcgcgggtgcg
gtttctggtcaagaagtgactaaagccgaagctgaagctgctgcacctgttgccgctgct
gtgactgaagagtctaacgatgcattaagcccatcagtacgtcgtttactggctgagcac
aatgttgatgcgagcaaagtgaagggcactggtgtcggtggccgtatcactaaagaagac
gttgaagcctttatcaagtctgcgcctaaagcggcagctgcccctgcggctccagcggta
caacctttagcggcaggtcgtagcgagaagcgtgttccaatgacacgtttacgtaagact
atcgctaaccgtttattagaagcgaaaaactctaccgcgatgctcacgaccttcaacgaa
gtgaacatgaagccaatcatggatatccgtaagcaatatcaggaaatctttgaaaagcgc
cacggtatccgtttaggtttcatgtctttctacgtgaaagcggttactgaagcgctgaaa
cgcttcccagaagtgaacgcgtcaatcgacggtgacgatatcgtttaccacaactacttc
gacgtcagcatcgctgtatcgactccacgtggtctggtcaccccagtattgcgtgatacc
gataccatgagcctggctgatatcgaaaaagcagtacgcgatctggcgatcaaaggccgt
gatggcaagctgactgtcgctgatatgactggcggtaacttcactgtgactaacggtggt
gtattcggctcgttaatgtctaccccaattttaaacctgccacagagcgcgattttaggc
atgcacgccattaaagaccgcccaatggcagtcaatggtcaggttgaaatcctgcccatg
atgtacctagctctctcatatgaccatcgtattgtcgatggccgtgagtcagttggcttc
ttagtcgccattaaagacttcttggaagacccaactcgtctgctacttgacctataa

DBGET integrated database retrieval system