KEGG   Shewanella sp. MR-7: Shewmr7_1711Help
Entry
Shewmr7_1711      CDS       T00389                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00020  Citrate cycle (TCA cycle)
shm00310  Lysine degradation
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
Module
shm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shewmr7_1711
  Amino acid metabolism
   00310 Lysine degradation
    Shewmr7_1711
Enzymes [BR:shm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Shewmr7_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABI42704
JGI: Shewmr71711
UniProt: Q0HW01
Position
2020276..2021472
Genome map
AA seq 398 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FQEGDTVLGEQVIAKFIAGAVSGQEVTKAEAEAAAPVAAAVTEESNDALSPSVRRLLAEH
NVDASKVKGTGVGGRITKEDVEAFIKSAPKAAAAPAAPAVQPLAAGRSEKRVPMTRLRKT
IANRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQEIFEKRHGIRLGFMSFYVKAVTEALK
RFPEVNASIDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDTDTMSLADIEKAVRDLAIKGR
DGKLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPM
MYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactgccagaatctgttgccgacgcaactatcgcc
acttggcacgtaaaagtgggtgagcaagtttctcgtgatcaaaatctggttgatattgaa
actgacaaagtcgtactggaagtggttgcaccagaagatggtcacatcggtgagttcctg
ttccaagaaggcgataccgttctgggcgagcaagtcattgctaagttcatcgcgggtgcg
gtttctggtcaagaagtgactaaagccgaagctgaagctgctgcacctgttgccgctgct
gtgactgaagagtctaacgatgcattaagcccatcagtacgtcgtttactggctgagcac
aatgttgatgcgagcaaagtgaagggcactggtgtcggtggccgtatcactaaagaagac
gttgaagcctttatcaagtctgcgcctaaagcggcagctgcccctgcggctccagcggta
caacctttagcggcaggtcgtagcgagaagcgtgttccaatgacacgtttacgtaagact
atcgctaaccgtttattagaagcgaaaaactctaccgcgatgctcacgaccttcaacgaa
gtgaacatgaagccaatcatggatatccgtaagcaatatcaggaaatctttgaaaagcgc
cacggtatccgtttaggtttcatgtctttctacgtgaaagcggttactgaagcgctgaaa
cgcttcccagaagtgaacgcgtcaatcgacggtgacgatatcgtttaccacaactacttc
gacgtcagcatcgctgtatcgactccacgtggtctggtcaccccagtattgcgtgatacc
gataccatgagcctggctgatatcgaaaaagcagtacgcgatctggcgatcaaaggccgt
gatggcaagctgactgtcgctgatatgactggcggtaacttcactgtgactaacggtggt
gtattcggctcgttaatgtctaccccaattttaaacctgccacagagcgcgattttaggc
atgcacgccattaaagaccgcccaatggcagtcaatggtcaggttgaaatcctgcccatg
atgtacctagctctctcatatgaccatcgtattgtcgatggccgtgagtcagttggcttc
ttagtcgccattaaagacttcttggaagacccaactcgtctgctacttgacctataa

DBGET integrated database retrieval system