KEGG   Shewanella sp. MR-7: Shewmr7_1805Help
Entry
Shewmr7_1805      CDS       T00389                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
shm  Shewanella sp. MR-7
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:shm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:shm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2127413..2128441
Genome map
AA seq 342 aa AA seqDB search
MSYLMLDLLSLDVSEAEAEMLRHPQVGGLILFSRNFSSREQLISLVQQIRQIRPEILIAV
DHEGGRVQRFREGFTLIPAMGDILPAAKGDMLLAKRWACELGFLMAIELLACDIDLSFAP
VLDLNGISQVIGKRSFSAKPDEVIALAQSFIEGMAEAGMGAVGKHFPGHGSVAADSHIAQ
AIDEREAEAIFNQDILPFKELIAKGKLSGIMPAHVIYPKVDPNPAGFSSYWLQQILRQEL
GFDGVIFSDDLGMKGASFAGDYLGRAQAALDAGCDMILVCNDNPGVMSLLNGFVWPDDAP
QHPTSLLKPNVAQTAIALENSARWENAKQLAEQIQLAQQAKV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagttatctaatgttggatctgctgtctttagacgtcagcgaagctgaggccgagatg
ctgcgccatccgcaagtgggcggtttgatcctgttttcccgcaatttttctagccgtgag
cagttaattagcttagtgcaacagatccgccaaattcgtcccgagattttgattgccgtt
gaccatgagggcgggcgagtacagcgtttccgtgaaggatttaccctgatcccggccatg
ggagatattttaccggcagccaagggcgatatgcttctcgctaaacgttgggcctgtgaa
ttaggctttttaatggccatcgaattactcgcctgtgacatcgacttaagttttgcgcct
gtgctcgatcttaacggcatcagccaagtcattggtaaacgtagttttagcgcaaagccc
gatgaagtgattgcgttagcgcagagttttattgagggtatggccgaggcgggcatgggc
gctgtgggtaaacatttccccggtcatggtagcgtggcggcggactcccatattgcgcaa
gctatcgatgaacgtgaagctgaggcgatttttaatcaagatattttgccatttaaagaa
ctgattgctaagggtaaattatctggcatcatgccagcccatgtcatttaccctaaagtt
gatcctaatcctgcaggtttttcatcctactggttacaacagattttacgccaagagctt
ggctttgatggggtgattttctccgacgatctggggatgaagggggcttcctttgcaggg
gattatttaggccgtgcccaagctgcgttggatgctggctgcgatatgattttggtctgt
aacgataatcctggtgtgatgtcgttgttaaatggttttgtatggcccgatgatgcgcca
caacatccgacgagtttactcaaacccaatgtggcgcaaaccgccatcgcattagaaaac
agtgcccgttgggaaaatgccaagcagctggcagagcaaatccaactcgcacaacaggca
aaagtttga

DBGET integrated database retrieval system