KEGG   Shewanella sp. MR-7: Shewmr7_1851Help
Entry
Shewmr7_1851      CDS       T00389                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
shm  Shewanella sp. MR-7
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:shm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Shewmr7_1851
Enzymes [BR:shm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Shewmr7_1851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2173176..2175308)
Genome map
AA seq 710 aa AA seqDB search
MISSALNPPKAPSIPWVEAGALRLKAPLTKLLKYWEKERLITPLDRHFALEMARLHPNDA
QEPLFMLLCALLSQQLSAQHTCLVLEHIVPANPLAEPVNHCQIRLSLPELIARLENFEAV
GEPHSNKPLIFDGGRLYLERYHHFETEVASALTRLSSSQPVNNTDKDSDAPLRRQLDYLF
PNAASSHATSALETNIDWQKVATATALGKKLAVITGGPGTGKTTTVTKLLLLQQLDSPKQ
IRLVAPTGKAAARLSESIKASKARLELELKQAQATNEQVHSHETQALLAALKQVPEEAST
LHRLLGVIPNSAQFRHHQGNPLRLDLLIVDEASMVDLPMMYKLLTALPEQAGLILLGDQD
QLASVEAGAVLADICAGLKYESEHESEQHSEWRMRYSQAQAEQLSKLTGFDLRAYIHREP
KIGDSLCMLTHSHRFKGDAGIGLLASAVNRSDLAGILAVWQRGLAELTWLEHSMDLSQTQ
AKISEPANNSGLRALLTQACEQYAEYLRPLQISDPSSVPSAIEAIARFNQYRILCAMRSG
DYGVEGINQAVTKALSQAKLIHPQQEFYLGRPIIIQSNDYNLGLFNGDIGLILQDEDRPE
RLMAHFIKADGKLLKVLPARLPSHETCYAMTVHKSQGSEFNRVALVLPPNPSLVQWQLLT
KELVYTAITRAKQHFSCLGTQQVFERASQQATQRASGLADRLWRGNAMTD
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgattagcagcgcactcaatccccctaaagccccatcaatcccatgggtcgaagctggc
gcgctcagactcaaggcgccgctcacaaagctactcaaatactgggaaaaggagcggctg
atcaccccgctcgatcgccattttgccctcgagatggcaaggcttcatcccaatgacgcc
caagagccgctgtttatgctgctttgcgccctgttaagtcaacagctctcggcccaacat
acttgcctagtgctcgaacatatagtgccagccaatccgctggcagagccggttaatcac
tgccagatccgtttgagcctgccagagctgattgcaaggctggaaaattttgaggcggtt
ggtgaacctcacagcaataagccactgatttttgatggcggccgactctatcttgagcgt
tatcatcatttcgaaaccgaggtggccagcgccctgacgaggctatcttcgagtcaaccc
gtcaacaacaccgataaagattcagatgcgccgctacgcaggcagctcgattacttattt
ccaaacgccgcatcttcccatgcaacatcagcccttgagactaatatcgactggcaaaag
gtggcgacggcaacggcgctcggcaagaagctggcggtgatcaccggcggcccaggcaca
ggcaaaaccaccacagtaactaaattactcttgttacagcaattagactcaccaaaacag
ataagactcgtcgccccgacgggcaaggccgccgcccgattaagtgaatcgataaaggcc
tcgaaagcaagactcgagctggagctcaaacaggctcaagcgacaaacgagcaagtacac
agtcacgaaacccaagcgctgttagccgcgctcaagcaagtgccagaagaggcatcaacc
ttacatcgtctgctgggggttatccccaattcggcgcagtttcgtcaccatcaaggcaat
cccctgcggctagatctcttgattgtcgatgaagcgtcgatggtcgatttgcctatgatg
tataagctgctcacggcccttcccgaacaggcgggtttgatactgctgggggatcaagac
caactcgcctcagttgaagcaggcgccgtgctcgccgatatttgcgcagggctaaaatat
gagtcggaacacgagtcggaacaacactctgaatggaggatgcgttatagccaagctcag
gctgagcaattgagcaaactcaccggctttgatctgcgtgcctatattcatcgcgagcca
aagattggcgatagtttgtgtatgttgacccacagccacagatttaagggcgatgccggc
attggcctattagccagtgcggtaaatcgctccgatctcgcggggattttggccgtatgg
caacggggactggccgagcttacttggctagaacacagtatggatctgagccagacccaa
gctaaaatcagcgagcctgcaaacaacagcggccttcgtgccctgctaacacaggcctgt
gagcaatacgccgagtatttacgtccgctgcaaatttcagatccaagcagtgtgccaagc
gccatcgaagccattgcccgctttaaccaatatcgcatcctatgcgccatgcgcagtggc
gattatggtgtcgaaggtatcaatcaagccgtgactaaggcgctgtctcaggccaagctt
atccatccccagcaagagttttaccttggcaggccgattattatccaaagcaacgactat
aacttgggcctgtttaacggtgatattggtttgattttgcaggatgaagacaggccagag
cgcctgatggcccactttatcaaagccgatggcaaactgcttaaagtgctccccgcaagg
ctgcctagccatgaaacctgctacgccatgacggtacataaaagtcagggcagtgaattt
aatcgagtcgccctcgtacttccgcccaatccgagcctagtacagtggcaattgctcacc
aaggagctggtctacactgctattacccgcgcaaaacaacactttagctgtttaggcaca
cagcaagtctttgagcgcgcaagccagcaagctacccagcgagcctcaggtttagccgat
agactctggcgcggtaacgcgatgactgattaa

DBGET integrated database retrieval system