KEGG   Shewanella sp. MR-7: Shewmr7_1872Help
Entry
Shewmr7_1872      CDS       T00389                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2207719..2208747
Genome map
AA seq 342 aa AA seqDB search
MSSSAANKELDSAAQILRLAVPQMSALDIPVTPENYTVWYEYFAQSNLDLNRAIDGFLAN
KVVFTKEVNTSLYKNFIQEKSPEVIENVQIETQILINSLISKITQLNQGTEAFSSTLADF
GLQLQTKHDVGTLNQLVDGVIDEMQSLLLNNQNMEQSLTAMGQEVQNLKAEMENLSLAAM
TDQLTSLHNRRAYEIAIQDHIHRAEEQQTRCSLLLIDIDRFKLFNDTYGHQVGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVLLPNTHFHDALQVAETLRERISERRLAIGKDKKLSL
GAITVSIGLASLQKGDDAETLFSRADKALYEAKSDGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttctgctgcaaataaagagctcgattctgcggcgcaaattttgcgattagcc
gtaccacaaatgtccgcgctcgatattcccgtgacccctgaaaactacacggtttggtat
gagtattttgcccagtcaaacctcgacttaaatcgcgctatcgacggttttctggcaaac
aaagtggtgtttactaaggaggtaaataccagtctatacaagaactttatccaagaaaaa
tcccctgaagtcatcgaaaacgtccaaatcgaaacccagatattaatcaactcgctgatc
agtaaaatcacccagttaaatcaagggacagaggcattttcaagcaccttggctgacttt
ggtcttcagctacagaccaagcacgacgtgggcacgctcaatcaattagtggatggggta
atagatgaaatgcaaagtctattactcaataaccaaaatatggagcagagcttaacggcc
atggggcaagaggtgcagaacttaaaagccgaaatggaaaacttaagtttggcggcaatg
acggatcaattaacctcattgcataaccgccgcgcctacgagattgccattcaagatcat
atccaccgcgccgaggaacaacaaacccgttgcagcctattactgattgatattgaccgc
tttaaattgtttaacgacacctatggccatcaagtgggggataaggtgttagcctatgtc
gcgctcgccctcaaacaatgtgtgcggggcgatgactttgtcgcccgttatggcggcgag
gagtttgttgttctgctgccaaacactcatttccacgatgcactccaagtggccgagacc
ttaagggagcggatctccgagcggcgtttagccataggcaaagataaaaaactctcactg
ggcgcgattaccgtatctatcggcttagcctcgttgcaaaagggggatgatgcggaaacc
ttattcagccgagcggataaagccttgtatgaggccaaatccgatggccgtaactgtgtt
cgtggctaa

DBGET integrated database retrieval system