KEGG   Shewanella sp. MR-7: Shewmr7_2109Help
Entry
Shewmr7_2109      CDS       T00389                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
shm  Shewanella sp. MR-7
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shewmr7_2109
Enzymes [BR:shm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Shewmr7_2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2490534..2493050
Genome map
AA seq 838 aa AA seqDB search
MALTTVPSQQARSLTHRRNLTRKPIALAIAASIIGVASLTGCSPSAPNADTSTPTVTKAT
DAQIAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDSIQNPISRVWFSVAQGILTETMY
GLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINRDVEGKYQ
IEKHIFTDPDRDTLMMRVTFTAFEAGITPHLYVNPHIDNAGANDIGRIDHQALIARTANP
HSSVMTVKSDIDFTQATTGFVGVSDGLADLADNGKLDTLYQATSNAEKPTQGNIAFTASY
PALQANQPLNVNLVIGFGHDETSSLANANASLTAGYDAVLSQYNAGWHSYLQSLPAMPDM
AQSTTDNGKLLYTSAMVLKAQEDKTYAGALIASLSNPWGDTVPAVTPSTGYKAVWPRDFY
QCAMAFLAMGDTQTPKVAFEYLKKVQVSDKTPGYSGTPGWFLQKTHVDGQIEWVGVQLDQ
TAMPIMLGWKLWQAGVLSQAELSHWYQEMLKAAADFLVSGGEVNLDWNHTQITPPKTQQE
RWEEQAGYSPSTTAAVLAGLVAASDIAKAVNDSDASQRYLATAKTLNQQLEKHLVTTQGL
LTDSQGIKAPYYLRLSPNGEPNTAEQLAANNGRAGLDQRQILDGGFLELVRYGVRGATDK
LINQSLALVDNTELEDNLRLKYNFTAKDGSSVPGFRRYGNDGYGEDTLTGANYAESGSNS
DNQRGRVWPFFTGERGHFELALASAKGELSGAHAQQTKQQLINTYVQGMETFANAGLMLP
EQAWDGVGNATRYQYQLGQGTNSATPLAWTHAEYIKLVRSMSDGRVWDNYPIVPEALK
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggcattgacaacagtaccttcgcagcaggctcgcagcttaactcaccgccgcaactta
actcgtaagccgattgcgctcgcaattgccgcaagcataatcggcgttgccagcttaacg
ggctgctcaccctcggcccccaatgcagacacatcaacaccaaccgtcacaaaagccaca
gacgcacagattgcccccggcgccccaggcaaagccccaacctgggcgttctccggcaaa
accggtatcggtacctcctatgagccttatactcaagggcaataccaagacagcatccaa
aatcccattagccgagtgtggttctccgtcgcgcaggggattttaaccgagaccatgtac
ggccttattcacaacgctcagctcaaagagttgcaatttgtgatcactggcaatggcttt
gtcgataccgaaaaagacaacactatcagcagcattgaatacttagataccgatgccaat
ggccgcccacaatccttggcctataagattatcaatcgcgatgttgaaggtaagtatcag
atagaaaaacatatctttaccgatcccgaccgcgatacgctgatgatgcgcgtgacgttt
accgcctttgaagcaggcatcacaccgcatttatacgttaacccccatatcgataatgcg
ggcgcgaatgatattggcagaatcgatcatcaagcccttatcgctcgcacggcgaatccc
cacagcagcgtaatgacagttaaatcggatatcgattttacgcaggcgaccacgggtttt
gtcggtgtatccgacggtttggccgatttagccgataacggcaagctcgatacgctgtat
caggccaccagcaacgccgaaaagcctactcaaggcaacattgcttttaccgccagttat
cccgcactccaagctaatcaacctcttaatgtgaatttggtgattggttttggccatgat
gaaacgagcagtttagccaatgccaacgccagcttaacggcggggtatgatgcagtgctg
agccaatacaacgctggttggcacagttatttacaatcgctacccgcgatgcctgatatg
gcgcaaagcaccacagataatggcaagctgctgtataccagtgccatggtactcaaggcg
caggaagataaaacctatgcgggcgcccttatcgcttcgctttctaatccttggggcgat
acagtccctgctgtcacaccgagcacgggctacaaggccgtttggccgcgagacttttac
caatgtgccatggcatttctcgccatgggcgatacgcaaacgcctaaagtcgcctttgag
taccttaaaaaggtgcaagtgagtgacaaaactccaggctatagcggcacgcccggttgg
ttcttacaaaagacccatgtggatggccaaatcgaatgggtgggcgtacagctcgaccaa
acggcgatgccgatcatgctcggctggaaactctggcaggcaggcgtgctgagtcaagcg
gaactgagccattggtatcaagagatgctaaaagccgcggcggactttttagtcagcggc
ggtgaggtgaatcttgactggaatcacacccaaattacgccaccgaaaacccaacaagaa
cgttgggaagaacaagctggttattcgccctccaccacggccgcagtgctcgcaggctta
gtggccgcgagtgatattgccaaggcagtaaacgatagcgatgccagtcagcgttatctc
gcaaccgccaaaacgcttaatcaacaacttgaaaaacacttagtgacgacccaaggtttg
cttaccgatagccaaggcattaaggcgccttactatttgcgcttaagccctaacggtgag
ccaaacaccgccgagcaactcgccgctaataatggtcgtgcgggattagatcaacgtcag
atcctcgatggcggctttttagagctggtgcgctacggcgtgcgtggcgccaccgataag
ctgattaatcaaagcctagcgctggtggataacactgagcttgaggacaatttacgcctc
aaatacaactttactgccaaagatggcagcagcgttcccggctttaggcgttacggtaac
gatggctacggtgaagataccctcactggcgcaaactacgccgaatctggcagtaatagc
gacaaccaacgcggccgcgtctggcccttcttcactggcgagcgtggccattttgaattg
gcccttgccagcgctaagggagagctaagcggtgctcacgcgcagcaaaccaaacagcag
ctaatcaatacctatgtgcaaggtatggaaacctttgccaacgcggggctaatgctcccc
gaacaagcatgggacggtgtgggtaacgccacacgttaccaatatcaactcggccaaggt
actaactccgccaccccgctcgcctggacccacgctgaatacattaagctggtacgttca
atgagcgatggtcgagtctgggataactaccctatcgtcccagaagcgttgaaataa

DBGET integrated database retrieval system