KEGG   Shewanella sp. MR-7: Shewmr7_2121Help
Entry
Shewmr7_2121      CDS       T00389                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
shm  Shewanella sp. MR-7
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:shm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:shm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2510336..2511481
Genome map
AA seq 381 aa AA seqDB search
MTHASNTHPVTELTKELIARPSVTPLDEGCQTLMAERLAAIGFNIEPMVFEDTTNMWARR
GNEGPVFCFAGHTDVVPAGDLSRWHTPPFEPTIIDGYLYGRGAADMKGSLAAMIVATERF
VAKHPNHPGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTLKLGDVVK
NGRRGSLTANLTVKGIQGHVAYPHLADNPIHKAAPFLAELSQTHWDNGNEFFPPTSMQIA
NINGGTGASNVIPGTLEVMFNFRYSTEVTAEILIERVEALLTAHELDYDISWTFNGLPFL
TGEGPLLDATRHAIRQITGYDTDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECV
KIDDLEQLALCYEVILEQLLC
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgcttcgaacacccacccagttaccgaactgactaaagaattaatcgcccgt
ccctctgtcaccccgctggatgaaggctgccaaaccctgatggccgaacgtcttgccgcc
attggctttaatattgagcccatggtctttgaagacaccaccaatatgtgggcgcgtcgc
ggtaatgaaggcccagtattttgttttgccggccataccgatgtagtgcccgcgggcgat
ttaagccgctggcataccccgccttttgagccaaccattatcgacggttacctctatggc
cgcggcgccgccgacatgaaaggctcgctggcggcgatgatcgtcgcgaccgaacgtttt
gtggctaagcacccaaatcaccccggctcgattgcgtttttgatcactagcgatgaagaa
ggcccctttatcaatggcaccacgcgggttatcgataccctagaagcccgtaatgaaaaa
atcacttgggcactggtgggcgaaccctcatcgaccctaaaactcggtgatgtggtcaaa
aatggacgccgtggcagcctgaccgccaacttaaccgttaagggcattcagggccatgtg
gcctatccgcaccttgcggataaccctatccacaaagccgcgccgtttttagccgagtta
agccaaacccattgggataatggcaacgaattcttcccgcccaccagcatgcaaatcgcc
aatattaacggcggcacgggcgcatcaaacgtgatcccaggcaccctagaggtgatgttt
aacttccgttattcaaccgaagtgaccgccgagatattaatcgagcgcgtggaagcctta
ttgaccgcccacgaactggattatgacatcagctggaccttcaacggcctgccattttta
actggcgaaggcccactgttagacgcgactcgacatgctatacgtcagatcactggctat
gataccgatccgcaaaccacgggcggcacctctgatggacgctttattgcaccaacgggc
gccaaagtgttggaactcggtccagtgaacgccactatccataaagtgaacgagtgcgtg
aagatcgacgatctcgagcagttagccctgtgctacgaagtgattttggaacaattactg
tgttaa

DBGET integrated database retrieval system