KEGG   Shewanella sp. MR-7: Shewmr7_2275Help
Entry
Shewmr7_2275      CDS       T00389                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
shm  Shewanella sp. MR-7
Brite
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Shewmr7_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2694613..2695638
Genome map
AA seq 341 aa AA seqDB search
MSRDLLQTAALNLKKAVPLMLKHQIPTTPINYALWYTYVGEQNPALNAQLDTVIAHFNTC
PPVSSELLFRQYVADPVELDVRDMRLNLEAMATELSQSIRDTNLDATEFQSCINTNFAKL
NGIEEGALSVEQVLDLVRNLVKESENIRSSTEFFTAQLQKAQTEIDALKQKLEKTEKDVL
YDALTGCLNRRAFDADIAGMLAQAPEGTCLIFVDIDHFKAFNDNYGHQLGDQVLKAVAKR
LQEACRDGCKLYRFGGEEFAIVVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDQRIDHIT
ASFGVAQWQEKQSVMQLIEKTDKLLYEAKRLGRNRVMPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagatttattacaaaccgcagccttgaatcttaaaaaagcggttcccttaatg
ctcaaacatcaaattcccaccacgccaatcaattatgccctctggtatacctatgttggg
gaacaaaacccagcactcaatgcccagcttgatactgtgattgctcacttcaacacctgc
ccgcccgtgagcagcgagttgttgttccgccagtatgtcgccgatccagttgagctggat
gtacgcgatatgcggctaaaccttgaggccatggccacagaattatcgcaatcgattcgg
gataccaatctggatgcaactgagttccaaagctgtattaacactaactttgccaaactc
aatggcatcgaagaaggtgcgctcagtgttgagcaagtgctcgatttagtgcgcaattta
gtcaaagaatccgaaaacattcgctcaagtactgagttttttaccgcccaattacaaaaa
gcccagacagagattgatgcgctgaagcaaaagctcgaaaaaaccgaaaaagatgtactg
tatgacgcgctgaccggctgtttaaaccgccgcgctttcgacgccgatatcgccggcatg
ttggctcaggcgcccgagggcacctgtcttatctttgtcgatatcgatcactttaaggcc
tttaatgataattacggccaccagctaggcgatcaagtattaaaagcggtggcaaagcgc
ttgcaggaagcctgtcgtgatggctgtaagttataccgcttcggtggcgaagagttcgcg
attgtggtgcctaagagccaactgcgtattgcgcggcaactggctgaagccatgcgccgc
ggccttgaaaaactcagcctcaaggatagacgtaaggatcaacgtatcgatcatatcacc
gcctcctttggtgtcgcccagtggcaagaaaagcaatccgtaatgcaactgattgaaaaa
acagataagttgctttacgaggccaaacgcctaggccgcaaccgagtcatgccgataagc
aactaa

DBGET integrated database retrieval system