KEGG   Shewanella sp. MR-7: Shewmr7_2434Help
Entry
Shewmr7_2434      CDS       T00389                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00010  Glycolysis / Gluconeogenesis
shm00620  Pyruvate metabolism
shm00640  Propanoate metabolism
shm00680  Methane metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01130  Biosynthesis of antibiotics
shm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shewmr7_2434
   00620 Pyruvate metabolism
    Shewmr7_2434
   00640 Propanoate metabolism
    Shewmr7_2434
  Energy metabolism
   00680 Methane metabolism
    Shewmr7_2434
Enzymes [BR:shm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Shewmr7_2434
Lipid biosynthesis proteins [BR:shm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Shewmr7_2434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N PhnJ
Motif
Other DBs
NCBI-ProteinID: ABI43419
JGI: Shewmr72434
UniProt: Q0HTY6
Position
2882230..2884182
Genome map
AA seq 650 aa AA seqDB search
MSSQSLYKVSGNIAANALVNNDQYKKMYQESIVNPEGFWREHGKRIDWIKPYTKIKKTSF
DDHNLSINWFYDGTLNASANCLDRHLAEHSDRVAIIWEGDNASEQRKITYGELHTQVCKF
ANALRSQGVRRGDIVTIYMPMVPEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKS
KVVITADEGMRGGRAIPLKRNIDDALKHPDVTSVEKVIVLKRTGGKVDWVEGRDVWWHSL
VETASEHCAIEEMGAEDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKPGEI
YWCTADVGWITGHSYMVYGPLANGATVLIHEGIPNHPSPARLGEMIDRHKVNILYTAPTL
IRALMAEGKQHFDKYDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGG
ILITPLPGATDTKPGSATRPFFGVQPALVDNMGNILEGATEGNLVLLDSWPGQMRTVYGD
HERFVLTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVSHE
LVAEAAVVGYPHDIKGQGIYAYVTLTRGTEESEELRQELRQWVRKEIGALATPDLIQWAT
GLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRNE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcagtctctctacaaagtctccggcaatatcgctgccaatgcacttgtaaat
aacgatcaatataaaaaaatgtaccaagagtcgattgtcaatccagagggtttctggaga
gagcacggcaaacgtatcgattggataaagccatacactaaaatcaaaaaaacctctttt
gacgatcataacttatcgattaactggttctatgacggcaccctaaacgcctcggctaac
tgcttagatcgccatctagctgaacacagtgaccgcgtcgccatcatctgggaaggtgat
aacgccagcgagcaacgtaaaatcacctacggtgagctacacacccaagtgtgtaagttt
gccaacgccctacgcagccaaggcgtacgccgtggggacattgtgaccatttatatgcca
atggtgccagaagcggctgtggcaatgctggcctgtgcccgcataggtgccgtgcactcg
gttgtctttggtggcttctcacccgattctatcgcttcacgggtcatcgacggtaaatct
aaagtggttatcaccgccgatgaaggtatgcgtggcggccgcgcgatcccactcaaacgc
aacatcgacgatgcgctcaagcatcccgatgtcaccagcgtagagaaggtaatcgtactt
aaacgtactggcggcaaggttgactgggttgaaggccgcgatgtgtggtggcactcacta
gttgaaaccgcatccgagcactgcgccattgaagaaatgggcgccgaagatccgctcttc
ttactttatacctcaggttcaaccggtaatcccaagggcgtattgcacaccaccggcggt
tatatggtgtatgcctctatgacccacgagtatgtgttcgattacaaacccggtgagatt
tactggtgtactgctgatgtgggttggatcactggtcactcctacatggtatatggcccg
cttgccaacggtgcgaccgtgctcatccacgaaggtatccccaatcacccaagccctgcg
cgtttaggcgagatgattgaccgccataaagtcaatattctctatactgcaccaacgctt
attcgtgcactaatggccgaaggtaaacaacattttgataagtacgatggcagctcactg
cgcatcatgggctcggtaggcgaacccatcaacccagaagcttggcgctggtaccacgag
gtcatcggtcatgagcattgcccaattgtcgatacttggtggcaaaccgaaactggcggt
attttgatcaccccactgccaggcgcaaccgataccaaacccggctcggcgactcgccct
ttctttggagtacaaccggcgctcgtagacaacatgggtaacattttagaaggcgcaacc
gaaggtaacctagtactgctcgactcttggccaggccaaatgcgtaccgtgtatggcgat
catgaacgcttcgtactgacctacttcaaaaccttccgtggcatgtactttaccggtgac
ggcgcacgacgcgatgaagatggttactactggatcactggccgtgtggacgatgtgatt
aacgtctctggtcacagattaggtaccgcagaggtagaaagtgcactggtatcacatgaa
ctggtcgctgaggccgcagttgtgggctatccccatgatatcaaaggccaaggtatttat
gcctacgtgacgctaacccgcggcacagaagagagtgaagaacttcgccaagagctgcgc
caatgggttcgtaaggaaattggtgccctagccacaccggatcttatccagtgggcaacg
gggttacctaagacccgttctggcaaaatcatgcgccgtttcctgcgtaagattgccgct
aacgaagtgaccaacttaggtgacgcatcaacactggccgatccagccgtgattgagacc
ttgattgaaactcgcttgaatcgtaacgagtaa

DBGET integrated database retrieval system