KEGG   Shewanella sp. MR-7: Shewmr7_2836Help
Entry
Shewmr7_2836      CDS       T00389                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
shm  Shewanella sp. MR-7
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shewmr7_2836
Enzymes [BR:shm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Shewmr7_2836
Exosome [BR:shm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shewmr7_2836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3364252..3366489)
Genome map
AA seq 745 aa AA seqDB search
MMTQAQTYFYDGSDVALLNGQYTDVFSLLGMHCINEGKALVVRCFLRNAQKVDVISLKDG
RKVASLERVNEAGLFAGTLGRRVKPFLYALRVVYPLCELDIIDPYQFGSLLDSQDLYLFG
EGGSEQAYRFLGANWRQVDSVEGVHFCVWAPNAKRVSVVGDFNHWDDTRHVMRQHMANGL
WEIFLPDVAEGAHYKFDLVYQNGERHAKSDPMATQMECAPNNASIVPKKHQHPWADTQWM
DKRATTAWHRAAMSIYEVQLGSWRRKGEFGEQYFDYQDLIEQLIPYVKEQGFTHIELMPV
SEYPFDGSWGYQPVGLYAPTHRFGDANGLKAFIDACHQAEIGVLLDWVAAHFPKDPHGLV
RFDGTCLYEHEDPRKGTHPDWDTLIYNYDRGEVRSFLLSNACYWLREFHLDGLRLDAVSS
MLYLDYSREPGQWLPNAYGGRENLEAIHFLQMLNQRLYQAFPGICMIAEESTAFAGVTKP
TDCGGLGFGFKWNMGWMNDSLSYLGRDPIYRQYHHNQLTFSLMYAYSEQFMLSISHDEVV
HGKGSLLHKIPGDDWQKFATLRAYYGFMWGHPGKKLLFMGSEFAQRDEWNHNHSLDWHLL
AFEPHQGVQRWLRDLNQLYRQFPALSVLDYESQGFRWLDCDNGRDSIFSFVRYGEGSDVP
LVFVVNMTPTLHQGFRIGLPQGGDFCEYLNSDSHLYGGSNQGNAGKVIAEDLPWQGMASS
ALITVPPLGCLILGPATDAPRDTSL
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcaagcccagacttacttctatgacggtagcgatgtcgcactgttaaatggt
caatatacggatgtgttttccctgctcggtatgcactgcatcaacgagggtaaggccttg
gtggtgcgctgttttttacgcaacgcccaaaaagttgatgtgataagccttaaggatggc
cgtaaggtagcgagccttgagcgcgtcaatgaggcggggctatttgcggggacgcttggc
agacgggttaagccctttttgtatgcgctacgggtggtttatcccctctgcgagctggat
attatcgatccttatcagtttggttctctcctcgatagtcaagacttataccttttcggc
gaaggaggctctgagcaggcctatcgctttttaggtgcgaactggcgccaagtcgatagc
gtcgaaggcgtgcatttttgcgtatgggcgcccaatgctaagcgggtttctgtggtgggg
gattttaaccactgggacgatactcgccatgtgatgcgccaacatatggccaacggctta
tgggagatttttctgcctgatgttgccgaaggcgcgcactataagtttgatttggtttat
caaaatggcgagcgccacgcgaaatccgaccccatggcgacccaaatggaatgtgcaccg
aacaatgcctccatagtgccgaaaaaacaccaacacccttgggcggatacacaatggatg
gacaaacgggcgaccacagcttggcatcgcgccgcgatgtctatctacgaagtgcagcta
ggctcttggcgccgaaaaggtgagttcggtgagcaatattttgattatcaagacttaatc
gagcaattaattccctatgtgaaggagcaaggttttacccatatcgagttgatgccagtc
agtgagtatcccttcgacggctcttgggggtatcaacccgttggcctgtatgcgccgacc
catcgttttggcgatgccaatggcttaaaggcctttatcgatgcctgccatcaggccgag
attggcgtgttactcgattgggtcgcggcgcatttccctaaggatccccatggccttgtg
cgtttcgatggcacttgcctctacgaacatgaagacccgcgcaaaggcacgcaccccgat
tgggatacgctgatctataactacgaccgcggtgaggtacgcagctttctgctcagcaat
gcttgctattggctgcgggaatttcacctcgatgggctcaggctcgatgcggtgtcatcc
atgttgtacctcgactacagccgcgaacccgggcaatggctgcccaatgcctatggcgga
cgggagaatttagaggcgattcattttctgcaaatgttgaatcaacgtttgtatcaagcc
ttccccggcatttgcatgatagccgaagagtcaaccgcctttgcgggggtgactaagccg
acagattgcggcggactggggtttggttttaagtggaatatgggctggatgaacgacagc
ctaagctacttgggccgcgatcccatctatcgccagtatcaccataaccagctgaccttt
agtttgatgtatgcctattcggagcaatttatgctgtcgataagccacgatgaagtggtg
cacggcaagggctctttgctgcataaaatccccggcgatgattggcaaaaatttgccacc
ctcagagcctattacggctttatgtgggggcatccgggcaaaaaactgctgtttatgggc
agcgagttcgcccagcgcgacgaatggaaccataaccatagcctcgattggcatttgctc
gccttcgagcctcaccaaggcgtgcagcgctggcttcgcgatctgaatcagctttatcgc
caattccccgccttatccgtgctcgactatgagtcacaaggttttcgctggctcgattgt
gacaatggccgcgacagtatttttagctttgtgcgctatggcgagggcagtgatgtgccc
ttagtgtttgtggtgaatatgacgcccactctgcaccaaggatttcgtatcggcttgccc
caaggcggggatttctgtgagtacctcaatagcgacagccatctctatggtggcagcaat
caggggaatgcgggcaaggtgattgccgaagatttaccttggcagggcatggcatcgagc
gcgttgatcactgttccgcctctgggttgcttaatcctcgggcctgcgacggatgcgcca
agagataccagcctatga

DBGET integrated database retrieval system