KEGG   Shewanella sp. MR-7: Shewmr7_2837Help
Entry
Shewmr7_2837      CDS       T00389                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
shm  Shewanella sp. MR-7
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:shm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3366507..3368912)
Genome map
AA seq 801 aa AA seqDB search
MGLEKLLYLRGVGADFTDCFGQYIRIPEADRQGILTCMLQEKNTQACEAKDEPLTSLPSG
DELDAQVYQLDAQHWTQVLPAFHWCYVDEPWVCLYLPQSYRGDLLLTFTCEQGERVILEV
PFSALKPIGDYRIQAQELAQFGNSHFANECQFLQYRLDLLGHEFHCRDAGDAAEQDSNAE
LRRSWENVSAALNTSNNKDNLSDLSCLGLGYHTLSVSLLGLADEQQDVATASTSAASNSS
ASNSSASKATEFHGTFMVAPRTAYQGVMSAVAQGKRHKPWGVSLQLYSLRSESQWGMGDF
GDLEQLIGLVAEYGADFIQLNPLHALDIAAPEHPSPYSPCDRRRLNPLYIHLPSVPEFEP
LKTEFAAKEWQETIALLNAENWLDYPKVSELKYRAFARLYTVFCEHHLQPNTPRAQRFED
FVAEQGAPLREFAQAESLRSPRAIAQDEGFYLYLQFVAEDQLQLCQLKAKEAGMGIGLIR
DLAVGAALQGVEVQANSQQFCLNASIGAPPDPFAPQGQNWGLTPLDPVKLKQHQYRHFIE
LTRANMTHCGALRIDHVMGLLRLWWWPLDKRLGHGAYVYYPVETLLAILCLESQRARCMV
IGEDLGLVPPDIIHRLYQAGVYSNELFYFCKDHQGFKPPSHYKFQSLMMLANHDVPTLVA
WWTGSDLHLRRQLELFNTDEQLGEALAGREQEKHQLAQCLISQGLLPETDIQQLDIEDLL
TAWMPFGASGNSALYSVQWCDLLGDRHAVNIPGTWLEYPNWQRRLPISLSEAAARPALAE
RLQRIAAARHLPETAAHTDTL
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggggctggagaagttgctgtatttgcggggcgtaggagcagactttaccgactgcttc
ggccagtacattcgcattcccgaggctgacaggcaagggattttgacttgtatgttgcag
gagaaaaatactcaggcctgcgaggcaaaggatgaaccattaacgagtttacccagtggc
gacgagcttgacgctcaggtgtatcaactcgatgcacagcattggacacaagtgttgccg
gcgtttcattggtgctatgtcgacgaaccttgggtctgtctgtatttacctcaatcttac
cgtggcgatctgctgctcacctttacctgtgagcaaggggagagggttatcctcgaggtg
ccgttttcggcgctaaaaccgattggggattatcggattcaggcgcaggagttagcacag
tttggcaatagccactttgccaatgagtgtcagttcctgcaataccgcctcgacctctta
ggtcatgagtttcattgccgtgatgcgggcgatgctgctgagcaagatagcaatgctgag
ctgcgccgttcatgggaaaatgtcagcgccgcactaaacacatctaacaataaagacaac
ttaagtgatttatcttgcttgggattgggctaccacacactgagcgtcagtttgcttggg
ctggcagatgagcagcaggacgtcgcaaccgcaagcacctcagcagcaagcaactcatca
gcaagcaactcatcagcaagtaaggcgactgagttccatggcacttttatggtggcaccg
agaaccgcctatcaaggggtgatgagcgctgtggctcaaggaaagcgccataaaccgtgg
ggcgtgagtcttcagctctatagtctgcgcagcgaaagccaatggggtatgggcgacttt
ggcgatttagagcaacttatcggtttagtggccgaatatggcgccgattttattcaactt
aatccattgcatgccttagatattgccgcgccggaacatccgagtccctatagtccctgc
gatcgtagaaggctgaatccgctgtatattcatttacctagcgtgcctgaatttgagcca
ttaaaaacggagtttgcagcgaaggagtggcaagaaaccattgccctactcaacgcggag
aactggctcgattaccccaaggtcagcgagcttaagtaccgcgcctttgcacgtttatac
actgttttttgcgaacaccatttacagcccaacacacccagggcgcagcgatttgaggat
tttgtggcagagcagggcgcgccgctcagggaatttgcccaagccgaatcgctacgcagc
ccaagggccatagcacaggatgaaggcttttatttatacctgcagtttgtggctgaagat
caactgcaattgtgccagctcaaagctaaagaagcgggaatgggcataggactcatccgc
gatttggccgtaggcgccgcgttgcaaggcgttgaggttcaagctaattcgcagcagttt
tgcttaaacgccagcataggcgcaccgccggatcccttcgcgccgcagggacaaaactgg
ggacttacccccctcgatcccgtcaagctaaagcagcatcaatatcgccattttattgag
ctgactcgcgccaatatgacccactgcggtgcgctgcgaatcgaccatgtgatggggctg
ctgcgactctggtggtggccactggataagcgcctcggccatggcgcctatgtgtattac
ccggtcgaaaccctgttggcgattctctgccttgagagtcaacgtgcccgctgtatggtg
attggtgaggatttaggcctagtgccgcccgatattattcatcgcctgtatcaggcgggg
gtttactccaacgagttgttctacttctgcaaagaccatcaaggctttaagccgccgagc
cactataagttccagagtttgatgatgctggcaaaccacgatgtgccgaccttagtcgcc
tggtggacgggcagcgatttgcacctgaggcgacaactcgaactgttcaataccgacgag
caattaggtgaggccttagccggacgtgagcaggaaaaacaccagctcgcgcagtgctta
atctcccagggcttattgccggagacagatattcaacagcttgatattgaagatttatta
acggcgtggatgccctttggcgcctcgggcaacagcgcactttacagcgtgcagtggtgc
gatctgctaggggatcgccatgcggtgaatatccccggcacttggctcgagtaccccaat
tggcagcggcgattgcccatcagcctaagcgaagctgcagctaggcctgcgctggctgag
cgtttgcaacgcattgctgcggcaagacatttgccagaaacggctgcacatacagatacc
ctttga

DBGET integrated database retrieval system