KEGG   Shewanella sp. MR-7: Shewmr7_2844Help
Entry
Shewmr7_2844      CDS       T00389                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00630  Glyoxylate and dicarboxylate metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01200  Carbon metabolism
Module
shm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Shewmr7_2844
Enzymes [BR:shm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Shewmr7_2844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABI43828
JGI: Shewmr72844
UniProt: Q0HSS7
Position
complement(3374510..3375832)
Genome map
AA seq 440 aa AA seqDB search
MTKATQTSRQAQIDAIKKDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKLW
DLVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPA
NSVPAVVARINNSFRRADQIQWSNGVNPEEENFVDYFLPIIADAEAGFGGVLNAFELMKS
MIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVETLVIARTD
ANAADLLTSDCDPYDRDFVTGERTSEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKPD
LEEARRFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLAG
IHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTTV
IQGGQSSVTALTGSTEEEQF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacacagacttcacgtcaggcacagattgacgcgatcaaaaaagattgg
gctgagaatccacgttggaaaaacgtacgtcgcccatacactgcagaggaagttgtggct
cttcgtggttctatcgtacccgaaaacaccattgccaaacgcggtgccgctaaactgtgg
gatttagtcaacggtggcgcaaaaaaaggttatgtgaactcgttaggtgcactgactggc
ggccaagcggtacaacaggctaaagccggtatcgaagcgatttacctgtctggttggcaa
gtggcggccgacgctaacttagcgggtactatgtacccagaccaatctttatacccagca
aactcagtgcctgctgtcgtagcccgtatcaacaactctttccgccgtgctgaccaaatt
cagtggagcaatggggttaatccggaagaagaaaactttgtcgattacttcctgccgatt
attgccgatgcggaagcgggttttggtggcgtactgaatgcgttcgagctgatgaagtcg
atgatcgacgcaggcgccgctggtgtgcactttgaagaccaattagcctcagtgaaaaag
tgtggccatatgggcggtaaagtattagtgccgacccaagaagcagtacaaaagttagtt
gcggcgcgtcttgccgccgacgtgagcggtgttgaaaccttagttatcgctcgtaccgat
gcgaacgcggcggatttattgacctccgattgcgacccatacgatcgtgacttcgtgact
ggcgagcgcaccagtgaaggtttctaccgcgtaaaagcgggtctggatcaagcaatttct
cgcggtcttgcctacgcaccatatgcggatttaatttggtgtgaaaccgctaagcctgac
ttagaagaagcacgccgctttgctgaggcaatccatgctcagtacccagaccaattactg
gcctataactgttcaccttcgttcaactggaagaaaaacttggacgacgcgacgattgcg
cgcttccaacaagcgctgtcggacatgggctacaagtatcagttcatcactttagcgggt
atccataacatgtggtacaacatgtttgacctcgcttacgactacgctcgtggtgaaggt
atgaagcattatgttgagaaagttcaagaagttgagtttgcagcagcgaagaaaggctac
accttcgtcgcgcatcaacaggaagtgggcacaggttacttcgaccaagttaccacagtg
atccaaggcggtcagtcttctgtgactgcactgacaggctcgaccgaagaagagcagttt
taa

DBGET integrated database retrieval system