KEGG   Shewanella sp. MR-7: Shewmr7_2845Help
Entry
Shewmr7_2845      CDS       T00389                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00620  Pyruvate metabolism
shm00630  Glyoxylate and dicarboxylate metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
shm01120  Microbial metabolism in diverse environments
shm01200  Carbon metabolism
Module
shm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shewmr7_2845
   00630 Glyoxylate and dicarboxylate metabolism
    Shewmr7_2845
Enzymes [BR:shm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Shewmr7_2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI Glyco_trans_1_2
Motif
Other DBs
NCBI-ProteinID: ABI43829
JGI: Shewmr72845
UniProt: Q0HSS6
Position
complement(3375976..3377625)
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTQNKATANGTLALVGNTIPGQEVIFTEGALALLESLCREFATEVPTL
LAKRKDRQARIDKGALPDFLPETRAIRDGAWKIRGIPNDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWQKVVEGQINLRDAVRGEIEYTAPETGKHYKLGPNPAVLICR
VRGLHLKEKHVEFNQQSIPGALFDFAMYFYHNYRQLLAKGSGPYFYIPKLESHIEARWWA
KVFAFVEERFCLQPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPAQNETVL
QRVRKDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHQNQLHITRDVDAPILAAEL
LKPCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKPVTKQLFKDMLVEELANVKKEVGGDRFTHGKFTQAAVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttaagtgaacagcaattgaattcgacacagaataaggccactgcg
aatggcactctggccttagtgggaaataccatcccggggcaggaggtgatttttaccgaa
ggcgcgctggcgttgcttgagtcactttgccgtgaatttgcgacagaagtgcccacctta
ctcgccaaacgtaaagatagacaggcgcgtatcgataaaggggctttgcctgacttttta
cccgagactcgcgctattcgtgatggtgcatggaagatccgtggcattccgaatgactta
ctcgaccgccgcgttgaaatcaccggtcccgtcgaacgtaagatggtgatcaatgcgctt
aatgccaatgccaaagtgtttatggcggattttgaagactccttagcaccgagctggcag
aaagtcgtggaaggtcagattaacctacgtgatgccgtgcgcggtgagattgagtacaca
gcgcctgaaaccggtaaacactacaagttaggcccaaatcctgcggtattaatctgccgt
gtgcgtggcctgcacttaaaagaaaagcacgttgaatttaaccagcagtccattcccggc
gcgttattcgactttgcgatgtacttttaccataactatcgccaattgctggcgaagggc
agtggcccttacttctatattcctaaactcgagagccatattgaagcgcgttggtgggca
aaagtgtttgcttttgttgaagaaagattttgcctacagcctggcacaatcaaatgtact
tgtttgattgagaccttacccgcggtgtttgaaatggacgaaattctctatgaattacgc
tcaaacattgtcgcgctgaactgtggtcgttgggactatatcttcagctatatcaaaaca
ttaaagcgtcatagcgaccgtgtattaccggatcgccaagcggtgaccatggatacgcct
ttcttaagcgcctattcaagactgctgatcaaaacctgccataaacgtggcgcactggcg
atgggcggtatggcggcctttattcccgctaaggatcccgctcaaaacgaaaccgtgttg
caacgggtacgtaaggacaaagagcttgaggctcgcaatggtcacgatgggacttgggtc
gctcacccaggtcttgcggatacggcaatggggatctttaacgaatacataggccaagat
catcaaaaccaattgcatatcacccgtgatgtggatgcaccgatccttgccgcagagtta
ttaaaaccctgtgatggtgagcgtacagagcaagggatgcgcctgaatattcgcatcgct
ctgcaataccttgaggcgtggattagtggcaacggttgtgtgccgatttacggattaatg
gaagatgcggcaacggcggaaatctcccgcgcctcgatttggcaatggatccaacatggc
aagtcactctcaaacggcaaacccgtcactaaacaattgtttaaggacatgctggtggaa
gagttagcgaatgtgaaaaaagaagtgggcggtgacagattcacccacggaaaatttacc
caagcggctgtattacttgaggatattaccacttcggatgagttggtcgatttcttaacc
ttacccggttacgagatgctaacggcttaa

DBGET integrated database retrieval system