KEGG   Shewanella sp. MR-7: Shewmr7_2845Help
Entry
Shewmr7_2845      CDS       T00389                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
shm  Shewanella sp. MR-7
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:shm01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:shm00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:shm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3375976..3377625)
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTQNKATANGTLALVGNTIPGQEVIFTEGALALLESLCREFATEVPTL
LAKRKDRQARIDKGALPDFLPETRAIRDGAWKIRGIPNDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWQKVVEGQINLRDAVRGEIEYTAPETGKHYKLGPNPAVLICR
VRGLHLKEKHVEFNQQSIPGALFDFAMYFYHNYRQLLAKGSGPYFYIPKLESHIEARWWA
KVFAFVEERFCLQPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPAQNETVL
QRVRKDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHQNQLHITRDVDAPILAAEL
LKPCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKPVTKQLFKDMLVEELANVKKEVGGDRFTHGKFTQAAVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttaagtgaacagcaattgaattcgacacagaataaggccactgcg
aatggcactctggccttagtgggaaataccatcccggggcaggaggtgatttttaccgaa
ggcgcgctggcgttgcttgagtcactttgccgtgaatttgcgacagaagtgcccacctta
ctcgccaaacgtaaagatagacaggcgcgtatcgataaaggggctttgcctgacttttta
cccgagactcgcgctattcgtgatggtgcatggaagatccgtggcattccgaatgactta
ctcgaccgccgcgttgaaatcaccggtcccgtcgaacgtaagatggtgatcaatgcgctt
aatgccaatgccaaagtgtttatggcggattttgaagactccttagcaccgagctggcag
aaagtcgtggaaggtcagattaacctacgtgatgccgtgcgcggtgagattgagtacaca
gcgcctgaaaccggtaaacactacaagttaggcccaaatcctgcggtattaatctgccgt
gtgcgtggcctgcacttaaaagaaaagcacgttgaatttaaccagcagtccattcccggc
gcgttattcgactttgcgatgtacttttaccataactatcgccaattgctggcgaagggc
agtggcccttacttctatattcctaaactcgagagccatattgaagcgcgttggtgggca
aaagtgtttgcttttgttgaagaaagattttgcctacagcctggcacaatcaaatgtact
tgtttgattgagaccttacccgcggtgtttgaaatggacgaaattctctatgaattacgc
tcaaacattgtcgcgctgaactgtggtcgttgggactatatcttcagctatatcaaaaca
ttaaagcgtcatagcgaccgtgtattaccggatcgccaagcggtgaccatggatacgcct
ttcttaagcgcctattcaagactgctgatcaaaacctgccataaacgtggcgcactggcg
atgggcggtatggcggcctttattcccgctaaggatcccgctcaaaacgaaaccgtgttg
caacgggtacgtaaggacaaagagcttgaggctcgcaatggtcacgatgggacttgggtc
gctcacccaggtcttgcggatacggcaatggggatctttaacgaatacataggccaagat
catcaaaaccaattgcatatcacccgtgatgtggatgcaccgatccttgccgcagagtta
ttaaaaccctgtgatggtgagcgtacagagcaagggatgcgcctgaatattcgcatcgct
ctgcaataccttgaggcgtggattagtggcaacggttgtgtgccgatttacggattaatg
gaagatgcggcaacggcggaaatctcccgcgcctcgatttggcaatggatccaacatggc
aagtcactctcaaacggcaaacccgtcactaaacaattgtttaaggacatgctggtggaa
gagttagcgaatgtgaaaaaagaagtgggcggtgacagattcacccacggaaaatttacc
caagcggctgtattacttgaggatattaccacttcggatgagttggtcgatttcttaacc
ttacccggttacgagatgctaacggcttaa

DBGET integrated database retrieval system