KEGG   Shewanella sp. MR-7: Shewmr7_2996Help
Entry
Shewmr7_2996      CDS       T00389                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K09471  gamma-glutamylputrescine oxidase [EC:1.4.3.-]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00330  Arginine and proline metabolism
shm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Shewmr7_2996
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     Shewmr7_2996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Thi4 NAD_binding_8 Amino_oxidase FAD_binding_3 Pyr_redox_3 FAD_binding_2 Pyr_redox_2 HI0933_like GIDA FAD_oxidored UDPG_MGDP_dh_N NAD_binding_9 AlaDh_PNT_C Lycopene_cycl Shikimate_DH NAD_binding_7 Pyr_redox 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABI43980
JGI: Shewmr72996
UniProt: Q0HSC5
Position
complement(3551199..3552485)
Genome map
AA seq 428 aa AA seqDB search
MSAIPHTGSYYAASANDKVERARLQESIEADVCVIGAGYTGLSAALHLLESGFSVVVLEA
ARIGWGASGRNGGQIVNSYSRDIDTIEKTVGKEQAKLFGQMAFEGGRIIRERIAKYNIDC
DLKDGGVFAAMNEKQMGHLRHQKQLWESHGHVGKLEMLDANGIRSVVNTERYVGGMLDKS
GGHIHPLNLALGEARAVESLGGKIFEDSAVLRVDEGDSPVVHTAKGSVKAKFVVVAGNAY
LGKLMPELQAKSMPCGTQVITTEPLDEELAASLLPQDYCVEDCNYLLDYFRLSGDKRLIY
GGGVVYGARDPADIESLIIPNMLKTFPQLKGVKVDYAWTGNFLLTLSRLPQVGRIGKNIY
YSQGCSGHGVTYTHLAGKLIAEMLNGQATRFDAFAALPHYPFPGGHALRVPFSALGAWYY
SLRDKLGI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccatacctcacactggatcatattatgcggcatcggccaacgataaggttgag
cgcgcgcgtttacaggaatcgattgaagccgatgtttgtgtgattggcgcggggtacaca
ggcctgtctgctgcactgcatttactcgaatcgggttttagtgtggtggtgcttgaagcg
gcgcgaattggttggggagcctcggggcgtaatggcggacaaattgtcaacagctatagc
cgtgacattgataccattgaaaaaaccgtcggtaaagaacaagccaagctttttggacaa
atggccttcgagggcggacgcattatccgtgaacgtatcgctaagtacaacattgactgc
gatctaaaggatggcggcgtatttgcggcgatgaacgaaaagcagatgggccatttacgc
catcaaaagcagttatgggaaagccatggccacgtgggcaagcttgagatgctcgatgca
aacggcattcgctctgtggtaaatactgagcgctatgtcggcggtatgttagataagagc
ggcggccacattcatccgctgaacttagccttgggtgaagcccgtgcggtagaatccctc
ggcggaaagatttttgaagactcagcggtgctacgggtcgatgaaggcgatagccctgtg
gtgcacaccgctaagggcagtgtaaaagccaagtttgtggtggtggcgggtaacgcttac
ctcggtaaactcatgcctgaattgcaagccaagtctatgccctgtggcacccaagtgatc
accaccgagcccttggacgaagagctggcagcaagcctattaccccaagactactgcgtc
gaagattgtaactatctgcttgattatttcaggctgtctggcgataagcgtctgatctac
ggcggtggtgttgtttatggtgcccgcgatcctgcggatatcgaatccctgattatcccg
aatatgctcaaaaccttcccacagttaaaaggggttaaggttgattatgcctggacgggt
aactttttattgaccttatcgcgtttaccacaggtcggccgtattggtaaaaatatctat
tattcacagggttgtagtggccatggcgtcacttatacccacttggcaggcaagttaatt
gccgaaatgctcaatggtcaagccacgcgtttcgatgcttttgcggcgctgccccattat
cccttccccggcggtcacgccttacgtgtgccttttagtgcgctgggggcatggtattac
agtttaagagataaattaggtatctaa

DBGET integrated database retrieval system