KEGG   Shewanella sp. MR-7: Shewmr7_3003Help
Entry
Shewmr7_3003      CDS       T00389                                 

Definition
(GenBank) transcriptional regulator, XRE family with cupin sensor
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3560004..3560630)
Genome map
AA seq 208 aa AA seqDB search
MFGMMFILNNLFFIYRGNRSFGEMRNLDIGASLRTVRKMKGLSQRELAKRAGVTNSTISM
IEKNSVSPSVSSLKKVLSGIPMSLVDFFSIEASIESEQKVVYRSDELLDIGTGPLEFKLI
GRDFPNRAMSVMSETYPPGSDTGEEMLKHEGEEAAMVIEGKFELTVGDEVYILEAGDSYY
FNSELPHRFRNPFDEPCRLVSATTPANF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgggatgatgtttatcctgaacaacctgttcttcatctatcggggcaaccgatcc
tttggggagatgcgaaatttggatattggagccagtctcagaactgttcgaaaaatgaaa
ggcttatcccagcgtgagctggctaagcgtgctggtgtgactaacagtacaatttcaatg
atcgaaaaaaacagtgttagcccatccgtcagttctttgaaaaaggtattgtcgggtatc
cctatgtctctagtggattttttctcgattgaagcctcgattgagagtgagcaaaaagtg
gtttatcgctccgatgaactcctcgatataggtactgggccgttagaatttaagttgatt
ggccgtgactttcccaatcgtgccatgtcggtgatgagtgaaacctacccaccgggttcg
gatacgggcgaggaaatgctgaaacacgaaggtgaagaggcggccatggtgatcgaaggc
aaattcgaactgaccgttggcgatgaggtatatatcttagaagcgggtgatagttactat
tttaacagtgagttaccccatagatttcgtaaccctttcgatgaaccctgtcgactggtc
agtgcaacaacgccagcgaatttctaa

DBGET integrated database retrieval system