KEGG   Shewanella sp. MR-7: Shewmr7_3007Help
Entry
Shewmr7_3007      CDS       T00389                                 

Definition
(GenBank) rare lipoprotein A
  KO
K03642  rare lipoprotein A
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DPBB_1 Barwin
Motif
Other DBs
NCBI-ProteinID: ABI43991
JGI: Shewmr73007
UniProt: Q0HSB4
Position
complement(3563739..3564182)
Genome map
AA seq 147 aa AA seqDB search
MLYIARMMNSFAKGCSVSLKYLSLTLMLLATLALSGCSSTHSGNWQGFTESGQASFYGDK
HQNKKTASGERYSHKLKTAAHKEIPFGSVVKVTNLMNGKTVVVKVNDRGPFVRGRIIDLS
KSAFSSIGNTSAGLLDVKIEVIQAASQ
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
ttgctgtacattgctcgtatgatgaactcatttgctaagggatgttctgtgagtctcaaa
tacttatctttgaccttaatgctgctagccaccttggccttatctgggtgttcttctacc
cattcgggaaactggcaggggtttaccgagtctggccaagcctctttctacggcgataaa
catcaaaataaaaaaaccgccagtggtgagcgttatagccataaattaaaaacggccgcc
cataaggaaattccttttggttcagtggttaaagtgacaaatctaatgaacggtaaaacg
gttgtggttaaggttaacgacagagggcctttcgtgcggggccgaattatagatttgtcc
aaatccgcatttagcagcataggcaatacttcggcgggtttactggatgtcaaaattgaa
gtgattcaagcggcgagtcagtaa

DBGET integrated database retrieval system