KEGG   Shewanella sp. MR-7: Shewmr7_3010Help
Entry
Shewmr7_3010      CDS       T00389                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase (acylating)
  KO
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
shm  Shewanella sp. MR-7
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Shewmr7_3010
   00562 Inositol phosphate metabolism
    Shewmr7_3010
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Shewmr7_3010
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shewmr7_3010
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     Shewmr7_3010
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     Shewmr7_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3567465..3568955
Genome map
AA seq 496 aa AA seqDB search
MLTMTHYVNGEHTAASTRSQEIFEPATGECRGQVSLASRDEVSAAIAIAKSAFDTWSQVT
PLNRARVLFKFKALVEQHMDELARLITLEHGKVLEDARGELIRGLEVVEFACGIPHLLKG
EHTEQVGGGVDAWSVNQALGVVAGIAPFNFPVMVPMWMFPIAIACGNTFIMKPSEKDPSA
VMRIAEFLTEAGLPAGVFNVVNGDKEAVDTLLSHEDIQAVSFVGSTPIAEYIYSTASKHG
KRVQALGGAKNHMLLMPDADLDQAVSALMGAAYGSAGERCMAISVVLAVGDVGDKLVDKL
LPQIQQLKVGNGLTPEMEMGPLISRQHHAKVTEFVDAGVQEGATLVVDGRQLTVADHQQG
YFLGACLFDNVTPEMRIYREEIFGPVLSIVRVKDYASALALINQHEFGNGTAIFTQSGEA
ARHFCHHVQVGMVGVNVPIPVPMAFHSFGGWKRSLFGPLHMHGPDGVRFYTKRKAITARW
PVGKQTQAEFVMPTMK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgctgacaatgactcattatgtgaatggcgagcacaccgccgccagtacaagaagccaa
gagattttcgaacccgctacgggagaatgccgaggtcaggtctccctcgcgagtcgcgac
gaagtctctgccgccattgctatcgccaaatcggccttcgacacttggtcacaggtaacg
cccctcaatcgtgctcgtgtgttatttaagtttaaagcgctggtcgagcaacatatggat
gagctggcgcgactgattaccttagagcacggcaaagtgctcgaagatgcgcggggagaa
cttatccgcggcctcgaagtcgtcgaatttgcctgtggtatcccacacttgctcaaaggg
gagcatacggagcaggtcggcggtggggtcgacgcttggtcagtcaatcaagctttaggt
gttgtcgcaggcatagcgccctttaacttccccgtgatggttcccatgtggatgttccca
atcgcgattgcctgcggtaacacctttattatgaaaccttcggagaaagacccaagcgca
gtaatgcgtattgcggaatttctcaccgaagctggtctccctgcaggggtatttaacgta
gtcaacggtgataaagaggccgtcgataccctgctcagccatgaagatattcaagccgtc
agctttgttggctccaccccgattgccgaatacatttacagcaccgcatctaaacacggt
aagcgggtgcaagccttaggcggcgcgaaaaaccatatgctattgatgccggatgcggat
ttagatcaagcggttagtgccctcatgggcgccgcctatggcagtgcgggcgagcgttgc
atggctatttcggtggtattagccgtaggagatgtgggcgacaagctagtcgataaatta
ttaccgcaaattcaacagttaaaagtgggcaatggcctcaccccagaaatggaaatgggg
ccgttgatctcccgccaacaccacgccaaagtcacggaatttgtcgacgctggcgtccaa
gaaggcgcgaccttagtggtggacggtcgtcagttaaccgtggccgatcatcagcagggt
tacttcttaggggcctgtttattcgataacgtcacccctgagatgcgtatttaccgcgaa
gaaatcttcggcccagtgctgtcgattgtgcgagttaaagactatgccagcgcactggcg
cttatcaaccaacatgaatttggcaatggcaccgccatctttacccaaagcggtgaagct
gccagacatttttgccaccatgtgcaggtcggtatggtaggggttaacgtgcccatccca
gtgcctatggccttccactccttcggtggctggaaacgttcgctctttggtcccctgcat
atgcatggtcctgatggggtacgtttttataccaaacgtaaagccatcacggcacgctgg
cccgtaggcaagcagactcaggctgagtttgttatgcccaccatgaaataa

DBGET integrated database retrieval system