KEGG   Shewanella sp. MR-7: Shewmr7_3027Help
Entry
Shewmr7_3027      CDS       T00389                                 

Definition
(GenBank) nitrogen regulatory protein P-II
  KO
K04751  nitrogen regulatory protein P-II 1
Organism
shm  Shewanella sp. MR-7
Pathway
shm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:shm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shewmr7_3027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P-II DUF3240
Motif
Other DBs
NCBI-ProteinID: ABI44011
JGI: Shewmr73027
UniProt: Q0HS94
Position
complement(3591211..3591549)
Genome map
AA seq 112 aa AA seqDB search
MKKVEAIIKPFKLDDVRESLAEIGITGMTVLEVKGFGRQKGHTELYRGAEYMVDFLPKVK
IELVIQDDLVDQAIDVIVETARTGKIGDGKIFVTDVERVIRIRTGEENEEAV
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttgaagcgattattaagccttttaaattggatgatgtacgcgagtcactt
gctgagataggtatcaccgggatgacagtgctggaggttaaaggttttggccgtcaaaaa
gggcacaccgagctttaccgcggtgcggagtatatggtcgactttttacctaaagttaaa
atagaactcgtgattcaagatgatttagtcgaccaagcgattgatgttattgtggaaaca
gctcgtaccggtaaaattggagatggtaagattttcgtaaccgatgtagagcgcgttatc
cgcattcggactggtgaagaaaacgaagaagcggtgtga

DBGET integrated database retrieval system