KEGG   Shewanella sp. MR-7: Shewmr7_3030Help
Entry
Shewmr7_3030      CDS       T00389                                 

Definition
(GenBank) conserved hypothetical protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TA_inhibitor
Motif
Other DBs
NCBI-ProteinID: ABI44014
JGI: Shewmr73030
UniProt: Q0HS91
Position
complement(3592947..3593249)
Genome map
AA seq 100 aa AA seqDB search
MMKLILGILLVVQPVLTLAATQSQSMQDYKCHVNLSKGDKVLFYRWKISEVNLKAAGLPG
AQRKSSDGKKYFIKDVVECVPLTQDFTGEESKLLDAGTLR
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcttattttgggtattttgttagttgtacaacctgttttgactcttgctgcg
acgcaatcacagtcaatgcaggactataaatgtcatgtgaatttatctaaaggggataaa
gtccttttttatcgttggaaaataagcgaagtaaaccttaaagcagctgggctaccggga
gcgcagcgtaaaagctctgatggtaaaaagtatttcattaaggatgtggttgaatgtgtt
ccgttaacccaagatttcacaggagaagaaagtaagctgttggatgctgggacattaaga
taa

DBGET integrated database retrieval system