KEGG   Shewanella sp. MR-7: Shewmr7_3035Help
Entry
Shewmr7_3035      CDS       T00389                                 

Definition
(GenBank) type IV pilus modification protein PilV
  KO
K02671  type IV pilus assembly protein PilV
Organism
shm  Shewanella sp. MR-7
Brite
Secretion system [BR:shm02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Shewmr7_3035
Bacterial motility proteins [BR:shm02035]
 Pilus system
  Pilus assembly proteins
   Shewmr7_3035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N_methyl 4HB_MCP_1
Motif
Other DBs
NCBI-ProteinID: ABI44019
JGI: Shewmr73035
UniProt: Q0HS86
Position
complement(3598787..3599347)
Genome map
AA seq 186 aa AA seqDB search
MTKCGHLTLTKYQQGISLIEVLVALVILVIGLIGIFNLHIVAKRGSFESFQQTQASYYAT
DIINRMKLNRTELANYNGTYSGTPTAVSKACEDNTLCNPAELKSWDIFEWQSLFIGAAET
VGSLNVGGLDTPTACVQVVGNDVLVAIVWKGISSTNIDTSAIEDTVVSCGSGTPNRRIFS
IRTVII
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatgtggacatttgacacttacaaaataccaacagggcatttcgttgatcgaa
gtgctggtcgcattggtgatcttagtcatcggcttaattggtattttcaacctgcatatc
gttgctaaacgcggcagttttgagtcatttcaacagactcaagcatcttactatgccact
gatataattaatcgaatgaagctcaatcgcactgaattagcgaactataatggaacctat
agcggaactcccactgcggtgagtaaagcctgtgaggataacactttgtgcaatcctgct
gagctgaaaagttgggatatttttgaatggcagtcgttgtttattggggctgctgaaaca
gtaggtagcctgaatgtaggtggtctggatactccaacagcttgtgttcaagttgttggt
aatgatgttttagtagccattgtatggaagggaattagtagcacaaacattgatacgtcc
gcaattgaggatacagttgtgtcatgtggttcagggacaccaaatcgtcgtattttttca
ataagaacagtgattatatag

DBGET integrated database retrieval system