KEGG   Shewanella sp. MR-7: Shewmr7_3040Help
Entry
Shewmr7_3040      CDS       T00389                                 

Definition
(GenBank) FMN adenylyltransferase / riboflavin kinase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
shm  Shewanella sp. MR-7
Pathway
shm00740  Riboflavin metabolism
shm01100  Metabolic pathways
shm01110  Biosynthesis of secondary metabolites
Module
shm_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:shm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Shewmr7_3040
Enzymes [BR:shm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     Shewmr7_3040
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     Shewmr7_3040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like Pox_P4A
Motif
Other DBs
NCBI-ProteinID: ABI44024
JGI: Shewmr73040
UniProt: Q0HS81
Position
complement(3604320..3605255)
Genome map
AA seq 311 aa AA seqDB search
MELIRGIHNILSSHHGCVLTIGNFDGVHRGHAQVVANLVQKAKQLSLPPTVMTFEPQPQE
LFRGENAPARLSLLRDKIILLDELGVERLVCVNFNRAFADQPAEHFIEELLVRKLGVKYL
VVGDDFCFGQGRKGNFEMLMQAGARYGFTVVSTQSFMVGSQRVSSTAVREQLAKGNLEQA
RRLLGHPFTLSGRVAHGQKIGRTIGFPTANIALKRNVVPVRGVFAVKLYWDESDIYEGVA
NIGFRPTVNGQVCQLEVHLFDFEGDIYGKHVEVELVAKLRDEQPFDSLDALKQQILNDAN
EARALFGNDAG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaattaatccgcggtatacataacattttgtcatctcaccatggctgtgtgctgacg
ataggtaattttgatggcgtgcatcgcggccatgcacaggtggttgccaatctggtgcaa
aaggccaagcagctctcattacctccgacagtgatgacatttgagcctcaaccacaggag
ttattccgtggtgagaatgcgcccgcgcgtctgagcttactgcgggataaaatcatcctg
ttagatgagttaggcgttgaacggttagtgtgtgttaacttcaaccgtgcctttgctgat
caaccggcggagcatttcatcgaagaactgttggtgcgcaagctcggggtgaaatacctc
gtcgttggcgatgacttttgcttcggtcaaggccgaaaaggcaattttgaaatgctgatg
caggcgggagctcgttatggctttaccgtggttagcactcaaagttttatggtgggctcg
caacgtgtgagttcgaccgcggtaagagaacaattggctaaagggaacctagagcaggcg
agacgcctactcggtcatccctttaccttaagcggtcgcgtggcccatggccaaaaaatt
ggccgaaccataggttttcccaccgccaatattgccctcaaacgcaatgtggtgcccgtg
cgcggggtgtttgcggtgaaactctattgggatgagagcgatatttatgaaggggttgcc
aacattggtttccgcccgaccgtaaatggtcaagtttgtcagctcgaggtgcatcttttt
gattttgaaggtgacatttatggcaagcatgttgaggttgagttagtggcaaaacttcgc
gatgaacaaccctttgattcattggatgcactaaaacaacagattttgaatgatgcaaat
gaggccagagctttatttggtaacgatgcaggctga

DBGET integrated database retrieval system