KEGG   Shewanella sp. MR-7: Shewmr7_3047Help
Entry
Shewmr7_3047      CDS       T00389                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
shm  Shewanella sp. MR-7
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:shm00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3612150..3614516
Genome map
AA seq 788 aa AA seqDB search
MTTTHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHSDIKPRLLGHWGTCPGINFVY
ANVNRLIVKHNRPFIYLVGPGHGFPAVQANLFIEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLVGDGESETGPLAASW
YANRLVSPATNGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYHPIIVDSEAEED
IYIQMATAMDTAYSMINDIQTRARKGEDIVKPRWPVILMRTAKGWTGVSEYNGTKLEGNC
ESHQVIVNKCATDKGHLAALDSWLASYQFQELYQINGQGELIFDADISSLIPPKHLACGR
QHLTYGGEVVRALSNPDLEKLSYGPEVPRGHRGYSMLKMGQWMRDAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDMSRDGRVLELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVVSSMADQYCKYVYASQGVHFRKPLPACNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAFADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVIIRELLPRVRIRFVSVTELSSDGL
GSRKFKEKPWMMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETKHVSITTDMLQRLVDHRNYIKANGVDPVE
IENWIWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacgactacacatgaaattaatgctcttaaaaagtatgtaagagccacaaacttcctc
gctacgtctcagatttatctaaaacaaaacgtattgcacaaacgcccccttgcgcattcg
gacattaagcctcgtttgctcggtcactggggaacttgtccaggtatcaactttgtctat
gccaacgtcaaccgactcattgtaaaacataatcgtcctttcatttacttagttggccca
ggccatggcttccctgctgtacaagctaacttattcattgaaggctcactcagccacttc
tacccagaaaccattccttataatgaaaccggcatcgaagatatctgtaagaagttttct
gcagcctatggttatccttcccatgcaaacccagaagcacctggtcaaatccttgaaggc
ggcgaattaggttattcattatcagttggctggggcgcagtattagacaacccagatctt
atcgctacagtattagttggtgacggtgaatcagaaactggtcctctggcagcatcttgg
tatgccaaccgcttagtttcacccgcaaccaacggtgctgtattgcctatcgtacatatc
aacggttataagatttcaggccctacccgtatgggacgcatgagccatgaagaattagat
cttgaattccgcggtcttggctaccacccaattattgttgacagcgaagcggaagaagat
atctacattcagatggcgaccgccatggataccgcttatagcatgatcaacgatattcaa
actcgagcacgtaagggtgaagatattgtcaaacctcgctggccagtgattttaatgcgt
accgccaagggctggacaggtgtgagcgaatataacggtacgaaattggaaggtaactgc
gagtcgcaccaagttatcgtcaataaatgtgccactgataaaggccacttagctgcgctg
gatagctggttagccagttatcaattccaagagctttaccaaatcaacgggcagggtgaa
ctgatttttgatgccgatattagctcactgatcccgccaaagcatttagcttgcggtcgc
caacatctcacttatggtggtgaagtcgtcagagccttatctaatccagatctagaaaag
ctcagctatggcccagaagtgccacgtggacaccgcggttactctatgctgaaaatgggt
caatggatgcgcgacgcattcaaattgaaccgtgatcaacgtaacttacgtatcttcagc
ccagatgaaacctattcaaaccagctgcaagcagtatttgaagaaaccgaccgcgcatgg
caatggccaattgaaagctgggacgaagacatgtctcgcgatggtcgagtactcgagttg
ctctcagagaacttactgtttggtatgctgcatggctacacagtgacgggacgtcacggt
atgttccctacctatgagtctttctcacaggtcgtatcctccatggctgaccaatattgt
aagtatgtttacgccagtcaaggagtgcatttccgtaagcctttaccggcgtgcaacgtg
gtactttcttcattattagaacgtcaagatcacaacggttattcgcaccagaacccatca
ttcctaggtgcgatgcttgaaaaacatccaaagattatttctgcttatttacccgcggat
gctaacagcaccttagtttataccgaacgtgcttttgcggatcgtgacaaattgaacatc
ctagtcgcaggtaaaaaagaactgccacaatggctcagtttagaagaagcgcgaaaacaa
gctaaagacggcgtcatggtgtgggattttgcttccgatgaaaatccagatatcgtgctt
gcaggttgtggtgattatgtcactcaagaatgtatggcctctttagtgattattcgtgaa
ctattacctagagtcagaattcgctttgtcagcgtgacagaattaagcagtgatggttta
ggtagtcgtaaatttaaagaaaaaccatggatgatggatgaaatatttacccaagataaa
ggggtagtatttaactatcacggttatccaaatacgatcaaaaagttaatatttgattac
aaaggaagccgtcgcttcagaattaaaggttacgaagaagaaggttcaacaaccactcca
tttgatatgggtgttcgaaatggcacttctcgctatcaccttgttattgatatggcttac
aaactattccagcaaggtgtcatcgacgaaaccaagcacgtttccatcacaaccgatatg
ctgcaaagactcgttgatcatcgcaactacattaaggcaaatggtgttgaccctgttgaa
attgaaaattggatttggacccgttaa

DBGET integrated database retrieval system