KEGG   Shewanella sp. MR-7: Shewmr7_3055Help
Entry
Shewmr7_3055      CDS       T00389                                 

Definition
(GenBank) von Willebrand factor, type A
  KO
K07114  Ca-activated chloride channel homolog
Organism
shm  Shewanella sp. MR-7
Brite
Transporters [BR:shm02000]
 Other Transporters
  Pores ion channels [TC:1]
   Shewmr7_3055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3520 vWF_A VWA VWA_2 VWA_3
Motif
Other DBs
NCBI-ProteinID: ABI44039
JGI: Shewmr73055
UniProt: Q0HS66
Position
complement(3621328..3623205)
Genome map
AA seq 625 aa AA seqDB search
MRYPSSVFRRKTLSSIVVSGLTLAILLGLNGCSDKSDDQQKRAELADQTKLAAEQQAELK
QQVELKDSVERQANRQRDAAIAIHEQATSTKLRTMNAEHRAYIAQPAATISAAPALNGDW
PGAVPPERNRFEKQVQNGIMVAGETPVSTFAIDVDTGSYTTLRRMLKEGRLPQKDTLRVE
EMLNYFSYDYPLPSKNEAPFSVTTELAPSPYNDDMMLLRIGLKGYEQSKAELGASNLVFL
LDVSGSMASPDKLPLLQTALKMLTQQLGAQDKVSIVVYAGAAGVVLDGAAGNDSQTLNYA
LEQLSAGGSTNGAQGIQLAYQLAKKHLVEGGINRVILATDGDFNVGTTNLDELIDLVSAQ
KQLGIGLTTLGFGMGDYNDHLMEQLADKGNGQYAYIDSLNEARKVLVEQLSATLLTIAKE
VKVQVEFNPALVAEYRLIGYENRALAREDFNNDKVDAGEIGAGHTVTALYELRYVDAGNL
ANDKLRYGYNPKTGNEKYSRDEIAFLKLRYQLPDATQSQLLSYPIRADQRANSLAQASDD
FRFAAAVAGLGQLLNQSHYLHQFDYNKLSALTRSALGEDTSGYRHEFMQLVDTAAVLAQT
QRVPIKKSFDAGDKPFPPEDKPHQQ
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgagatatccatcttcagtctttcgccgtaaaacgctctcgagcattgtcgtttcggga
ttaacactcgctattttgctcggcttgaatggttgcagtgataaatccgacgaccagcaa
aagcgtgctgaattagccgatcaaacaaaactcgccgccgagcaacaggctgagcttaag
cagcaagtagagttaaaggacagtgttgagcgtcaggccaataggcaaagagatgctgca
atcgccatacatgaacaagccacgtcaacaaaattgcggacaatgaatgctgagcatcga
gcctatatcgctcagcctgctgccactatcagtgctgcgcccgcgttaaacggcgattgg
cctggggctgtgccaccagagcgcaatcgatttgagaaacaagtgcaaaacggcatcatg
gttgcgggggaaacccctgtctcgacctttgcgatcgatgtcgatactggtagttacacg
acgttaaggcgaatgctaaaggaggggcgattaccgcaaaaggacacgctgcgggtcgaa
gaaatgctgaattatttttcctatgactatccattaccgagtaaaaatgaggcgccgttt
agtgttacgactgagcttgctccatcgccctataacgatgacatgatgttacttcgcatc
ggtttgaagggatatgagcagagtaaagctgaactgggcgccagtaacttagtgtttctg
ctggatgtgtcgggttctatggcatcgcccgataagttacctctattgcaaactgccttg
aaaatgctgactcagcaactgggtgctcaggataaggtatcgattgtcgtctacgctggc
gcagccggtgttgtgttagatggcgcggcgggtaacgacagtcaaacccttaactatgcg
ttagagcagctcagtgcgggtggttctaccaatggggcgcagggtattcagcttgcctat
cagcttgcgaaaaagcacttggttgaaggcggcatcaatcgagtgatacttgcgaccgac
ggtgactttaatgtcggcacgactaacctcgatgagttaatcgatttggttagcgcgcag
aagcaactgggcattgggctaacgacgctcggctttggtatgggcgactacaatgaccat
ctaatggagcaattagccgataaaggcaatggacaatacgcctatattgattccctcaat
gaagcgagaaaagtgctggtggaacagttaagtgcaaccttactgaccatagccaaagag
gtgaaagtgcaggtcgagtttaatcccgcccttgtggctgagtatcgtcttattggttat
gagaaccgtgccttagcgcgtgaagattttaataatgataaggtggatgcgggcgaaata
ggcgctgggcatactgtgacggcgctatatgagctgcgttatgttgatgcgggaaatttg
gctaatgataaacttcgctatggctataatcccaagactggcaatgaaaaatatagccgt
gatgaaatcgcctttctgaaattacgttatcagctaccggatgcgactcagagccagtta
ctgagttatccaattcgtgccgaccaaagggcaaactcattagcgcaggcgagtgacgat
tttcgttttgccgctgcagtggcaggattaggacagttactgaatcaaagccactatttg
catcaatttgattataataagcttagtgcgctcacacgttctgcgctgggggaagatact
agcggctaccgacatgaatttatgcaacttgtcgataccgctgcggtactcgcacaaaca
cagcgagtgccaatcaaaaaatcctttgatgccggagataaacctttcccgcccgaggat
aaaccgcatcagcaatga

DBGET integrated database retrieval system