KEGG   Shewanella sp. MR-7: Shewmr7_3072Help
Entry
Shewmr7_3072      CDS       T00389                                 

Definition
(GenBank) ATPase AAA-2 domain protein
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
shm  Shewanella sp. MR-7
Brite
Chaperones and folding catalysts [BR:shm03110]
 Heat shock proteins
  HSP100
   Shewmr7_3072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 ClpB_D2-small AAA Clp_N AAA_5 AAA_16 Sigma54_activat AAA_22 TniB AAA_14 AAA_24 AAA_18 IstB_IS21 ATPase_2 RNA_helicase DUF815 NACHT AAA_19 AAA_3 AAA_25 ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: ABI44056
JGI: Shewmr73072
UniProt: Q0HS49
Position
complement(3648243..3650816)
Genome map
AA seq 857 aa AA seqDB search
MRLDRMTNKFQLAISDAQSLALGRDHQFIEPLHLMMALLNQDSGSIHPLLTQAGIRVSAL
RSLLSQELERLPQVEGTGGDVQLSQGLIRLLNLCDKLAQKRKDKYISSELFVLAALEGSD
ALAQCLKKSGATKELLEQTIEQVRGGQNVDDPNAEDQRQALKKFTVDLTERAEQGKLDPV
IGRDDEIRRTIQVLQRRSKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGIKNKRVLSL
DMGALIAGAKYRGEFEERLKAVLNELAQEEGQVILFIDELHTMVGAGKGDGAMDAGNMLK
PALARGDLHCVGATTLDEYRQYIEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYELH
HHVEITDPAIVAAATMSHRYVSDRKLPDKAIDLIDEAASSIRMQMDSKPESLDRLERRAI
QLKLEEQALAKENDEASRRRLEHLRVELHEVEAKASELNEIWRTEKAALAGTQHIKADLE
QARMDLEVARRAGDLTRMSELQYGRIPELEKQLDLASQAEMQDMTLLRNKVTDLEIAEVL
SKATGIPVSKMLEGEREKLLQMEVALHERVIGQNEAVDAVANAIRRSRAGLADPNRPIGS
FLFLGPTGVGKTELCKSLAKFLFDTESALVRIDMSEFMEKHAVSRLVGAPPGYVGYEEGG
YLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVIIMTSNL
GSDIIQEGFGHLSYSEMKSAVMNVVTHSFRPEFLNRIDESVVFHPLDAENIKHIASIQIA
SLRKRLAEKDYTLEITDEALSLIAEIGFDPVYGARPLKRALQQEMENPLAQKLLRGDLLP
GKPIKVSCAGGELVFEQ
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcgatcgtatgaccaataaatttcagcttgccatctcagatgcccagtcgcta
gcgctcgggcgtgatcatcagtttatcgaaccgttacatttgatgatggcgctgctcaac
caggattctggttcaatccatcctttattaacccaagctggcattcgggtgagtgcgctg
cgctcgctgttgagccaagagcttgaacgtctaccgcaggtcgaaggcactggcggcgat
gtacaattatcccaaggtttaattcgcttattaaacctgtgcgacaagttggcgcaaaag
cgcaaagacaaatatatctccagtgagttgtttgtcttagcggcactcgaaggcagcgat
gccttggcgcaatgcttaaagaaatcaggcgccaccaaagagctgctcgagcaaaccatt
gagcaagtgcgcggcggtcagaatgtggatgatcctaacgcggaagatcaacgccaagcg
ctgaaaaagtttaccgtcgatctcactgagcgtgccgagcaaggcaaacttgaccctgtg
attggtcgtgacgatgaaatccgccgcaccattcaagtgctgcaacgccgtagtaaaaac
aacccagtgctgattggtgagccaggcgtgggtaaaaccgcgattgttgaaggactcgct
cagcgaattgtgaacggtgaagtgcctgaagggattaaaaataaacgcgttttatcctta
gacatgggcgcactgattgcgggcgctaaatatcgtggtgagtttgaagagcgtttaaaa
gccgtgcttaacgagctggcgcaggaagaaggccaagtgatcctctttatcgacgagctg
cacactatggtgggcgcgggtaaaggcgatggcgccatggatgcgggcaatatgttaaag
cctgcactggcccgtggcgatcttcactgtgtgggcgcgaccactctcgacgaatatcgt
caatatattgaaaaggatgccgcccttgagcgccgcttccaaaaagtattagtggatgag
cctagcgttgaagacaccatcgcgattttgcgtggtctcaaagaacgctacgagctgcat
caccatgtggaaattaccgatccggcaattgtggcagcggccaccatgtcgcaccgttat
gtgtcggatcgtaaattgcccgataaagccatcgacttaattgacgaggcggcatcgagc
atccgtatgcagatggattctaagcctgaatctctcgacagattggagcgccgtgctatt
cagttgaaactggaagagcaggcattagccaaagaaaacgatgaggcgagccgccgtcga
ctcgaacatttgcgtgtcgagttacatgaagttgaggctaaggcgtcggagcttaatgaa
atctggcgcaccgaaaaagcggcgcttgcagggactcagcatattaaagccgaccttgag
caggcgcggatggatttagaagtggcgcgccgcgcaggcgacttgacccgtatgtccgag
ctgcaatatggccgtattccagagcttgaaaagcaactggacttagcatcgcaagccgaa
atgcaggatatgacgctgctacgcaataaagtcactgacttagaaattgccgaagtgtta
tcaaaggcgacgggtattccggtttctaagatgctcgaaggcgagcgtgaaaaactgttg
caaatggaagtggcactgcatgagcgggtgattggccaaaacgaagccgtggatgcggtc
gccaatgcgattcgccgtagccgcgcagggcttgccgatccgaatcgtcctattggttcg
ttcctgttcttaggaccaaccggtgtgggtaaaactgagctgtgtaagtcgttggctaag
tttttattcgatacggaatcagccttggtgcgcatcgacatgtctgaatttatggagaaa
cacgcggtttcccgtttagtgggggcgcctccaggctatgtcggttatgaagagggcggt
tatttaaccgaagcggtgcgtcgtaagccttattcggtgatattgctcgatgaggtggaa
aaggctcacccagacgtgttcaatattttgctgcaggtgctggatgatggccgcttaacc
gatggtcaaggccgtaccgtcgactttagaaatacggtgatcatcatgacctcaaactta
ggctctgacattatccaagaaggattcggtcacctaagttacagcgaaatgaagagcgcg
gtgatgaatgtggttacccatagctttagacccgagtttctaaaccggatcgacgagtca
gtggtattccatcccttggatgcggaaaatatcaagcatattgcatctatccaaattgct
tcattgcgtaagcgtttggcagagaaagactatacgctggagatcaccgacgaggcatta
tcgttaatcgccgaaattggtttcgacccagtctatggcgcaagaccgctgaaacgtgcc
ttgcagcaagagatggaaaacccattagcgcaaaaattactgcgtggcgatttactgccc
ggcaaacctattaaggtcagttgcgccggtggtgagttggtattcgagcaataa

DBGET integrated database retrieval system