KEGG   Shewanella sp. MR-7: Shewmr7_3077Help
Entry
Shewmr7_3077      CDS       T00389                                 

Definition
(GenBank) globin
  KO
K05916  nitric oxide dioxygenase [EC:1.14.12.17]
Organism
shm  Shewanella sp. MR-7
Brite
Enzymes [BR:shm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.17  nitric oxide dioxygenase
     Shewmr7_3077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Globin NAD_binding_1 FAD_binding_6 Protoglobin NAD_binding_6
Motif
Other DBs
NCBI-ProteinID: ABI44061
JGI: Shewmr73077
UniProt: Q0HS44
Position
3656115..3657308
Genome map
AA seq 397 aa AA seqDB search
MLDSRTIQIIKSTIPLLESAGPALTQHFYQRMFTHNPELKDVFNLAHQHSGGQPVALFNA
VAAYAKNIDNLGALGTAVERIAQKHTGFLIQPEQYAIVGGHLLATLQELGGEAVTEEVLT
AWGDAYQFLANIFIQREAQIYQESAQQDGGWSGVREFIISEKKAESAVITSFVLTPTDGQ
AVKDFTPGQYLSIKLQHPKLAFDEIRQYSLSDAPNGRTYRISVKREPNGQVSNLLHDMLQ
VGDTVSVMPPAGDFALTAQPETPIVLISAGVGQTPMKSMLNQLLKLKHPSAVTWLHACEH
GEVHGFKTAVKSKLGQHANLASHVWYREPKEADILGQDYDFEGTMNLTSVADKIATDAHY
YFCGPIGFMASIKQQLLAFGVPSEQMHYEVFGPHAEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttggatagccgtaccatccagattattaagagcactattccccttctcgaatcagca
ggtcctgcactgacccagcatttttaccaacggatgtttacccacaatcctgagttaaaa
gatgtgtttaacttggctcatcaacattcaggtggtcagcccgtcgccttgtttaacgca
gttgcagcctatgccaagaacatcgataacctaggtgcattaggtacggccgtcgagcgc
attgcccaaaagcacactggttttttaattcagcctgaacaatatgccattgtcggcggt
caccttctggccacactacaagaactgggaggagaggcggttaccgaagaagtactcacc
gcatggggcgatgcttatcaatttttagctaacatttttatccagcgcgaagcacagatt
tatcaagaaagtgctcaacaggatggcggttggtctggggttcgtgagtttattattagc
gagaaaaaagccgagtcagccgtaatcacctcgtttgtcttaacgccaactgatgggcaa
gcggtaaaagacttcactccggggcaatacttgagcattaagctgcaacatcctaagctc
gccttcgatgaaattcgtcagtactcgctgtctgatgcgccaaatggccgaacctaccgc
attagcgtgaaacgagaacctaatggccaagtatcaaacctgcttcacgatatgttgcaa
gtgggcgatacagtttcagtcatgccgcctgcgggtgatttcgccttaacggctcagcca
gagactcctatcgtattgatttcggcaggagttgggcaaacgccgatgaagagtatgttg
aaccagttgctcaaactaaaacacccaagtgctgtcacttggttgcacgcttgcgagcat
ggtgaagtacacggctttaaaacagcggttaaaagcaaacttggtcaacatgccaatctt
gccagtcatgtgtggtatcgagagcctaaagaggcagacattttaggacaagattatgat
tttgaaggaacgatgaacttaacctcagtcgccgataaaatcgctaccgatgcgcattac
tatttctgcggcccgattggcttcatggcttctatcaagcagcaattactcgcctttggt
gtgcctagcgagcagatgcattatgaagtcttcggtccacatgccgagctataa

DBGET integrated database retrieval system