KEGG   Shewanella sp. MR-7: Shewmr7_3096Help
Entry
Shewmr7_3096      CDS       T00389                                 

Definition
(GenBank) secretion protein HlyD family protein
Organism
shm  Shewanella sp. MR-7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 Biotin_lipoyl_2 HlyD_D23 HlyD RED_N HrpB7
Motif
Other DBs
NCBI-ProteinID: ABI44080
JGI: Shewmr73096
UniProt: Q0HS25
Position
complement(3672338..3673483)
Genome map
AA seq 381 aa AA seqDB search
MDLLLILTYASICIVIFKVFKIPMNKWTVPTAVLGGVVLIGALLLIMNYNHPYSRFAREY
YATIPITPAVKGLVISVDVKPNTPIKQGDVLFRIDPTPFEAVVKRKRAALLAAEQEVPQL
EAAWESAKANVARVAADRERNKSAYDRYEQGHRKGGANSPFTALELDNRRQLFLASEAQL
TAAQAEELRARLAYESNVDGVNSKVAGLQGDLESALYNLEQTVVRAPADGIVTQMALRPG
AMAVPLPLRPVMSFIPDEQRYFAGAFWQNSLLRLQEGDEAEVVLDAAPGQVFKGKVAKVL
PAMAEGEIQMNGTLQSSNQLFQTGRVIVLIDIEDDAIRRQFPAGVAGQVAVYTEHFHHVA
VMRKVLLRMQGWLNYLFFDGH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggatttactattgatattaacctatgcctcgatctgtattgtgatttttaaagtcttt
aagatcccgatgaacaaatggacagtgcccacggcggtattagggggcgtggtccttatc
ggggcgttgttgctgattatgaactacaaccatccctattcacgttttgcgcgggaatac
tatgccactattccaatcactccagcggtaaaagggttagtgatttcggtggacgttaag
cctaatacgccgattaaacaaggggatgtgctgtttcgaatcgatcccactccctttgaa
gccgtggttaaacgcaaaagagccgctctgttagcggcggagcaggaagtgccacaactt
gaggccgcttgggagtctgccaaggcgaatgtggccagagtggcagcggatagggaacgt
aataaatcggcctatgaccgttatgagcaaggccaccgcaaaggtggggcgaactcaccc
ttcacagcgctggaattagataacagacgccaactgtttttagcctcagaggctcagcta
acggctgcgcaggccgaagagttacgcgcacgtcttgcctatgagtccaatgtggatggg
gtcaattctaaagtggcgggactacaaggtgaccttgaaagtgcgctctataatctcgag
caaaccgtcgtgcgggcaccagccgatggtattgtgactcaaatggcgctgcgcccaggt
gcaatggcggtgcctttgcctttacggccggtgatgagttttatccccgacgagcagcgt
tattttgctggcgcattctggcaaaactccctactgcgattacaggaaggggatgaggcg
gaagtggtattagatgcggcgcctggacaagtgtttaaaggtaaagtcgctaaggtactc
cccgcgatggccgaaggcgagatccagatgaatggcacgctgcaatcgtccaatcagcta
ttccaaacagggcgggttatcgtgttaatcgatattgaagacgatgcgatacgccgccaa
ttcccagcgggcgttgcgggacaagtggctgtgtacactgaacatttccatcatgtcgcc
gtgatgcgtaaagtgctgctgcggatgcagggctggttaaactatctgttcttcgatggg
cactag

DBGET integrated database retrieval system